Product Name CAS MF MW Synonyms
FARNESYL BROMIDE, 95% (MIXED ISOMERS) 6874-67-5 C15H25Br 0 FARNESYL BROMIDE, 95% (MIXED ISOMERS)
Farinomalein 1175521-35-3 C10H13NO4 211.21452;g/mol 3-(2,5-dioxo-3-propan-2-ylpyrrol-1-yl)propanoicacid; Farinomalein; CHEMBL1082049; ZINC49792972; HE299608; 2,5-dihydro-3-(1-methylethyl)-2,5-dioxo-1H-pyrrole-1-propanoicacid
FA-Phe-OMe 36020-63-0 C17H17NO4 299.33 3-(2-Furyl)acryloyl-L-phenylalanine methyl ester; FA-Phe-OMe
FA-Phe-Gly-Gly-OH 64566-61-6 C20H21N3O6 399.4 FA-PHE-GLY-GLY-OH; FAPGG; 3-(2-FURYL)ACRYLOYL-PHE-GLY-GLY-OH; 3-(2-FURYLACRYLOYL)-L-PHE-GLY-GLY; ANGIOTENSIN-CONVERTING ENZYME SUBSTRATE; N-[3-(2-FURYLACRYLOYL)]-L-PHENYLALANINE-GLYCL-GLYCINE; arginine-glycine-proline-phenylalanine-proline-isoleucine
Fandofloxacin 164150-99-6 C20H18F2N4O3
FAMPHUR-O-ANALOG 960-25-8 C10H16NO6PS 309.28 FAMPHUR-O-ANALOG; FAMPHUR-O-ANALOGUE; FAMPHUR-OXON; dimethylp-(dimethylsulfamoyl)phenylphosphate; famoxon; phosphoricacid,dimethylester,esterwithp-hydroxy-n,n-dimethylbenzenesulfon; phosphoricacid,dimethylester,esterwithp-hydroxy-n,n-dimethylbenzenesulfon
Falimint 553-20-8
FALGPA 78832-65-2 C23H32N4O7 476.52 2-furanacryloyl-leucyl-glycyl-prolyl-alanine; FA-LEU-GLY-PRO-ALA-OH; FALGPA; COLLAGENASE SUBSTRATE II; N-(3-[2-FURYL]ACRYLOYL)-LEU-GLY-PRO-ALA; N-[3-(2-FURYL)ACRYLOYL]-L-LEUCYL-GLYCYL-L-PROLYL-L-ALANINE; clostridiopeptidase; N-(3-(2-FURYL)ACRYLOYL)-L-LEUC
EXO-3,6-EPOXY-1,2,3,6-TETRAHYDROPHTHALIC ACID 28871-62-7 C8H8O5 184.15 exo,exo-7-oxabicyclo(2.2.1)hept-5-ene-2,3-dicarboxylicacid; exo,exo-7-oxabicyclo(2.2.1)hept-5-ene-3-dicarboxylicacid; EXO-3,6-EPOXY-1,2,3,6-TETRAHYDROPHTHALIC ACID; 3,6-OXA-1,2,3,6-TETRAHYDROPHTHALIC ACID; Epoepoxyxytetrahydrophthalicacid; EXO-3,6-EPOXY-1
exo-3,3-dimethylbicyclo[2.2.1]heptane-2-carbonyl chloride 61175-88-0 C10H15ClO 186.6785 exo-3,3-dimethylbicyclo[2.2.1]heptane-2-carbonyl chloride; Bicyclo[2.2.1]heptane-2-carbonyl chloride, 3,3-dimethyl-, exo- (9CI); exo-3,3-Dimethyl[2.2.1]heptane-2-carbonylchloride
EXO-2-CHLORO-5-OXO-BICYCLO[2.2.1]HEPTANE-SYN-7-CARBOXYLIC ACID 64812-06-2 C8H9ClO3 188.61 EXO-2-CHLORO-5-OXO-BICYCLO[2.2.1]HEPTANE-SYN-7-CARBOXYLIC ACID; exo-2-Chloro-5-oxo-bicyclo[2.2.1]heptane-syn-7-carboxylic acid,99%
EXO-2-BROMO-5-OXO-BICYCLO[2.2.1]HEPTANE-SYN-7-CARBOXYLIC ACID 63377-25-3 C8H9BrO3 233.06 EXO-2-BROMO-5-OXO-BICYCLO[2.2.1]HEPTANE-SYN-7-CARBOXYLIC ACID; EXO-2-BROMO-5-OXO-BICYLO[2.2.1]HEPTANE-SYM-7-CARBOXYLIC ACID
EXO-2-BROMO-5-OXO-BICYCLO[2.2.1!HEPTANE-SYN-7-CARBOXYLIC ACID, 99 63557-38-0 C8 H9 Br O3 233.06 EXO-2-BROMO-5-OXO-BICYCLO[2.2.1!HEPTANE-SYN-7-CARBOXYLIC ACID, 99; EXO-2-BROMO-5-OXO-BICYCLO2.2.1aHEPTANE-- SYN-7-CARBOXYLIC ACID, 99%
EXO-2,3-EPOXYNORBORNANE 3146-39-2 C7H10O 110.15 exo-2,3-Epoxynorbornane; 3146-39-2; norborneneoxide; SCHEMBL15423608; ZINC36437467
Exepanol 77416-65-0 C11H15NO2 193.245
EXENDIN-4 (3-39) 196109-31-6 0 EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2; EXENDIN-4 (3-39); EXENDIN (3-39); H-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2; M.W. 3992.42 C176H272
Euquinine 83-75-0 C23H28N2O4 396.48 Euquinine; Quinine ethylcarbonate
EUPHORBIA HIRTA EXTRACT 73049-60-2
Eupergit(R) CM 920278-43-9
Eupatorium rebaudianum,ext. 92332-31-5
Eupatorium cannabinum, ext. 84625-34-3
Eupacunin 33854-15-8 C22H28O7 404.45352;g/mol Eupacunin;33854-15-8;AC1O5LC2;NSC135020;[(3aR,4R,5Z,7S,9S,10Z,11aR)-9-acetyloxy-7-hydroxy-6,10-dimethyl-3-methylidene-2-oxo-3a,4,7,8,9,11a-hexahydrocyclodeca[b]furan-4-yl](Z)-2-methylbut-2-enoate;2-Butenoicacid,2-methyl-,9-(acetyloxy)-2,3,3a,4,7,8,9,11a-o
Eucalyptus globulus, ext. 84625-32-1 0 Eucalyptus globulus, ext.; EUCALYPTUS GLOBULUS LEAF EXTRACT; Eucalyptus globulus, Extrakt; EUCALYPTUSOEL EXTRA; Eucalyptus globulus extract; Einecs 283-406-2; Eucalyptus extract; Extract of eucalyptus
EUCALYPTUS DIVES OIL 90028-48-1 0 EUCALYPTUS DIVES OIL; Eucalyptus dives, ext.; Eucalyptus dives, Extrakt
Eucalyptus Citriodora Oil 75% 8055-93-4
Eucalyptus citriodora oil 85203-56-1
Etridiazole 2593-15-9 C5H5Cl3N2OS 247.53 SUPER X; TERRAZOLE; TERRAZOLE (TM); OM 2424(R); TRUBAN; KOLAN
Etriciguat 402595-29-3 C22H16FN7 397.415 ETRICIGUAT
Ethynerone 3124-93-4 C20H23ClO2 330.853 Ethynerone; (17S)-21-Chloro-17-hydroxy-19-norpregna-4,9-dien-20-yn-3-one; MK-665
Ethyl-tris(dimethylsiloxy)silane 150320-87-9 C8H26O3Si4 282.63 3-[(Dimethylsilyl)oxy]-3-ethyl-1,1,5,5-tetramethyl-trisiloxane; ethyltris(dimethylsiloxy)silane
Ethyltris(2-Hydroxyethyl)Ammonium Ethyl Sulphate 31774-90-0
ETHYLTRIPROPYLTIN 3440-79-7 C11H26Sn 277.03414 ETHYLTRIPROPYLTIN; Ethyltri-n-propyltin
ETHYLTRIPHENYLTIN 5424-25-9 C20H20Sn 379.0828 ETHYLTRIPHENYLTIN; Stannane, ethyltriphenyl-; ethyl-tri(phenyl)stannane
Ethyltriphenylphosphonium, salt with 4-chloro-3,5-xylenol (1:1) 93840-99-4 C28H28ClOP 446.94800
Ethyltriphenylphosphonium, salt with 4-chloro-2-cyclohexylphenol (1:1) 93840-94-9 C32H34ClOP 501.03900
Ethyltriphenylphosphonium, salt with 2-benzyl-4-chlorophenol (1:1) 94231-02-4 C33H30ClOP 509.01700
Ethyl-triphenylphosphonium chloride 896-33-3 C20H20ClP 326.8 ETHYLTRIPHENYLPHOSPHONIUM CHLORIDE; ETPPCL; ETC; TRIPHENYL ETHYL PHOSPHORUS CHLORIDE; ethyltriphenyl-phosphoniuchloride; Phosphonium,ethyltriphenyl-,chloride; TriphenylEthylphosphoniumchloride; Ethyltriphenylphosphoniumchloride,98%
ETHYLTRIPENTYLTIN 198958-44-0 C17H38Sn 361.19362 ETHYLTRIPENTYLTIN; ETHYLTRI-N-PENTYLTIN
ETHYLTRICYCLOHEXYLTIN 106376-80-1 C20H38Sn 397.22572 ETHYLTRICYCLOHEXYLTIN
Ethyltoulenesulfonamide 26914-52-3 C18H26N2O4S2 398.54 N-ETHYL-2-METHYLBENZENESULFONAMIDE; N-ETHYLTOLUENESULFONAMIDE; Ethyltoulenesulfonamide; N-Ethyltoluenesulfonamide (o- p- mixture); N-ethyl-2(or 4)-methylbenzenesulfonamide; N-ethyl-o(or p)-toluenesulfonamide; N-ethyl-o(or p)-toluenesulphonamide; santicize
ETHYLTHIOETHYL METHACRYLATE 14216-25-2 C8H14O2S 174.26 2-methyl-2-propenoicaci2-(ethylthio)ethylester; beta-(ethylthio)ethylmethacrylate; methacrylicacid,2-(ethylthio)ethylester; ETHYLTHIOETHYL METHACRYLATE; 2-(ETHYLTHIO)ETHYL METHACRYLATE; Methacrylic acid 2-(methylthio)ethyl ester
Ethylenediaminetetraacetic acid tetrapotassium salt 5964-35-2 C10H12K4N2O8 444.6 (ethylenedinitrilo)tetra-aceticacitetrapotassiumsalt; Glycine,N,N'-1,2-ethanediylbis[N-(carboxymethyl)-,tetrapotassiumsalt; n,n'-1,2-ethanediylbis(n-(carboxymethyl)-glycintetrapotassiumsalt; n,n'-1,2-ethanediylbis[n-(carboxymethyl)-glycintetrapotassiumsal
Ethylenediaminetetraacetic acid iron(III) potassium salt 54959-35-2 C10H12FeN2O8.K 383.16 potassium; 2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate; iron(3+); 54959-35-2; ETHYLENEDIAMINETETRAACETICACIDIRON(III)POTASSIUMSALT; 15275-07-7(Parent)
Ethylenediaminetetraacetic acid iron(III) monosodium salt 10346-69-7 FeNa
Ethylenediaminetetraacetic acid disodium magnesium salt tetrahydrate 29932-54-5 (NaOOCCH2)2NCH2CH2N(CH2CO 430.56
ETHYLENEDIAMINETETRAACETIC ACID DISODIUM CADMIUM SALT 30363-28-1 C10H12CdN2Na2O8 446.6 disodium; 2-[2-[bis(carboxymethyl)amino]ethyl-(carboxylatomethyl)amino]acetate; cadmium; 30363-28-1; Edtadisodiumcadmiumsalt; C10H12CdN2O8.2Na
ETHYLENEDIAMINETETRAACETIC ACID DIAMMONIUM SALT MONOHYDRATE 304675-80-7 C10H24N4O9 344.32 EDTA-NH4 MONOHYDRATE; DIAMMONIUM EDTA MONOHYDRATE; DIAMMONIUM ETHYLENEDIAMINETETRAACETATE MONOHYDRATE; ETHYLENEDIAMINETETRAACETIC ACID DIAMMONIUM SALT MONOHYDRATE; Ethylenediaminetetraacetic acid hydrate diammonium salt
Ethylenediaminetetraacetic acid diammonium copper salt solution 67989-88-2 387.83 Copper diammonium EDTA, Diammonium copper ethylenediaminetetraacetate solution
Ethylenediaminetetraacetic acid copper salt (EDTA-Cu) 61916-40-3 C10H16CuN2Na2O10 433.77 EDTA DISODIUM CUPRIC SALT; EETHYLENEDINITRILO)TETRAACETIC ACID COPPER DISODIUM SALT 97%; EDTA DISODIUM CUPRIC SALT 97%; COPPERDISODIUMEDTADIHYDRATE; Ethylenediaminetetraacetic acid, copper(II) disodium salt dihydrate,98%; Cuprate(2-), ((N,N'-1,2-ethanediy
ETHYLENEDIAMINETETRAACETIC ACID CALCIUM DISODIUM SALT HYDRATE 39208-14-5 C10H14CaN2Na2O9 392.28 ETA-NA2-CA N-HYDRATE; ETHYLENEDIAMINETETRAACETIC ACID DISODIUM CALCIUM SALT N-HYDRATE; ETHYLENEDIAMINETETRAACETIC ACID CALCIUM DISODIUM SALT HYDRATE
Ethylenediamine-N,N'-dipropionic acid dihydrochloride 32705-91-2 C8H18Cl2N2O4 277.15 ETHYLENEDIAMINE-N,N'-DIPROPIONIC ACID DIHYDROCHLORIDE; Ethylenediaminedipropionic acid dihydrochloride; ethylenediamine-n,n-dipropionicacid2HCl; ETHYLANEDIAMINE-N,N''-DIPROPIONIC ACID, DIHYDROCHLORIDE; Polyester granular,dispersed dyes in normal pressure;
Ethylenediamine-N,N,N',N'-tetraacetic acid, tetrasodium salt, dihydrate 1964-2-8
Ethylenediamine-N,N,N',N'-tetraacetic acid, amine salt 66558-66-5
Ethylenediamine-N,N,N',N'-tetraacetic acid disodium-zinc salt 15304-64-0 C10H12N2Na2O8Zn 399.57000
Ethylenediamine-N,N,N',N'-tetraacetic acid calcium-disodium salt 6766-87-6
Ethylenediaminediacetic acid dipropionic acid 32701-19-2 C12H20N2O8 320.3 Ethylenediaminediacetic acid dipropionic acid; Ethylenediamine-N,N'-diacetic-N,N'-dipropionic acid
ethylenediamine, salt with phosphoric acid 14852-17-6 C2H8N2.xH3O4P 0 ethylenediamine, salt with phosphoric acid; 1,2-Ethanediamine, phosphate; 1,2-Ethanediamine, phosphate (1:); Einecs 238-914-9
Ethylenediamine, propoxylated 25214-63-5 C27H20ClF3N2O5S 0 1,2-Ethanediamine, polymer with methyloxirane; SUCROSEAMINEPOLYETHERPOLYOL; Polyether (403)
Ethylenediamine Tetramethylenephosphonic acid 1429-50-1 C6H20N2O12P4 436.12 N,N,N',N'-ETHYLENEDIAMINETETRA(METHYLENEPHOSPHONIC ACID); [1,2-Ethanediylbis[nitrilobis-(methylene)]]tetrakis-phosphonic acid; edtmp; EDTPO; ETHYLENEDIAMINE TETRA(METHYLENEPHOSPHONIC ACID); ETHYLENEDIAMINE-N,N,N',N'-TETRAKIS(METHYLENEPHOSPHONIC ACID); Eth
Ethylenediamine sulfate 25723-52-8 C2H10N2O4S 158.18 1,2-ethanediamine,sulfate; 1-2-DIAMINOETHANE SULFATE; ETHYLENEDIAMMONIUM SULFATE; ETHYLENEDIAMINE SULFATE; ethylenediamine, salt with sulphuric acid; 1,2-Ethanediamine/sulfuric acid,(1:x); Ethylenediamine/sulfuric acid,(1:x)
ETHYLENEDIAMINE MONOHYDRATE 16889-59-1 C2H10N2O 78.11 ETHYLENEDIAMINE MONOHYDRATE; 1,2-DIAMINOETHANE MONOHYDRATE; 1,2-ETHANEDIAMINE MONOHYDRATE
ethylenediamine hydrochloride 15467-15-9 96.5601
Ethylenediamine D-tartrate 76891-07-1 C6H14N2O6 210.19
Ethylenediamine di-L-(+)-tartrate 996-78-1 C10H20N2O12 360.27 ETHYLENEDIAMINE DI-L-(+)-TARTRATE; ETHYLENEDIAMINE L(+)-TARTRATE
Ethylenediamide perfluoro(2,5-dimethyl-3,6-dioxa)nonanoic acid 1309602-81-0 C20H6F34N2O6 1016.2171
Ethylene-d4-diamine-1-N-t-BOC 509148-73-6
ETHYLENE-D4-DIAMINE DIHYDROCHLORIDE 34334-71-9 C2H6Cl2D4N2 137.04 ETHYLENE-D4-DIAMINE 2HCL; ETHYLENE-D4-DIAMINE DIHYDROCHLORIDE; ETHYLENE-D4-DIAMINE 2HCL 98%
ETHYLENE-D4-DIAMINE 37164-19-5 C2H4D4N2 64.12 ETHYLENE-D4-DIAMINE; ETHYLENE-D4-DIAMINE, 98 ATOM % D; 1,2-Ethane-1,1,2,2-d4-diamine
ETHYLENE-D4 GLYCOL 2219-51-4 C2H2D4O2 66.09 ethylene-d4glycol(oh,od); ETHYLENEGLYCOL-D4; ETHYLENE GLYCOL-D4 (OH-OD); ETHYLENE-D4 GLYCOL; 1,2-ethane-[2H4]diol; ETHYLENE-D4 GLYCOL (OH,OD), 98 ATOM % D; ETHYLENEGLYCOL-D4 99 ATOM% D; 97Atom%d,packagedinampules
ETHYLENE-D4 CARBONATE 362049-63-6 C3D4O3 92.09 ETHYLENE-D4 CARBONATE; Ethylene carbonate-d4
Ethylenebisdithiocarbamic acid 111-54-6 C4H8N2S4 212.37972 Ethylenebisdithiocarbamic acid; Carbamodithioic acid, 1,2-ethanediyl-bis-, salts &esters; N,N'-Ethylenedi(dithiocarbamic acid); C005270; Nabam, ammonium salt; Nabam, calcium salt (1:1); Nabam, diammonium salt; Nabam, dipotassium salt
ETHYLENEBIS(TRIPHENYLPHOSPHINE)PLATINUM(0) 12120-15-9 C38H34P2Pt 747.7 ETHYLENEBIS(TRIPHENYLPHOSPHINE)PLATINUM(0); Ethylenebis(triphenylphosphine)Platinum(II); bis(triphenylphosphine)(ethylene)platinum(0); Ethylenebis(triphenylphosphine)platinum(0),98%
ethylenebis(oxyethylene) dibenzoate 120-56-9 C20H22O6 358.388 ethylenebis(oxyethylene) dibenzoate; Ethanol, 2,2-1,2-ethanediylbis(oxy)bis-, dibenzoate; Reaktionsprodukt aus Triethylenglykol mit Benzoesure; 2,2'-[1,2-ethanediylbis(oxy)]bis-ethano dibenzoate; 2-[2-(2-phenylcarbonyloxyethoxy)ethoxy]ethyl benzoate; 2-[2
Ethylenebis-(isothiouronium bromide) 6943-65-3 C4H12Br2N4S2 340.1 2,2'-ethylenebis(2-thio-pseudouredihydrobromide; 2,2-ethylenedithiodi-pseudouredihydrobromide; carbamimidothioicacid,1,2-ethanediylester,dihydrobromide; ethylenediisothioureadihydrobromide; ethylenediisothiouroniumdibromide; ETHYLENEBIS(ISOTHIOUREA) DIHYD
Ethylenebis(9-fluorenyl)zirconium dichloride 148799-37-5 C28H20Cl2Zr 518.59 1,2-ETHYLENEBIS(9-FLUORENYL)ZIRCONIUM DICHLORIDE; Ethylenebis(9-fluorenyl)zirconium dichloride
ETHYLENEBIS(1-INDENYL)TITANIUM(IV) DICHLORIDE 112531-76-7 C20H16Cl2Ti 10* 375.11 ETHYLENEBIS(1-INDENYL)TITANIUM(IV) DICHLORIDE; RAC-/MESO-DICHLOROETHYLENEBIS-(1-INDENYL)-TITANIUM(IV)
ETHYLENE/METHACRYLIC ACID IONOMER, SODIUM ION 25608-26-8 C18H27Na3O6X2 408.37 POLY(ETHYLENE-CO-METHACRYLIC ACID), SODIUM SALT; ETHYLENE/METHACRYLIC ACID IONOMER; ETHYLENE/METHACRYLIC ACID IONOMER, SODIUM ION; ETHYLENE-METHACRYLIC ACID IONOMER, SODIUM ION IONOMER; ETHYLENE/METHACRYLIC ACID IONOMER, ZINC ION; ETHYLENE-METHACRYLIC ACI
ETHYLENE/ETHYL ACRYLATE COPOLYMER 9010-86-0 C21H36O6X2 384.51 ETHYLENE/ETHYL ACRYLATE COPOLYMER; POLY(ETHYLENE-CO-ETHYL ACRYLATE); 2-Propenoicacid,ethylester,polymerwithethene; poly(ethylene-ethylacrylate; POLY(ETHYLENE-CO-ETHYL ACRYLATE), MELT I NDEX 6; POLY(ETHYLENE-CO-ETHYL ACRYLATE), MELT I NDEX 20; Ethylene-eth
Ethylene Sulfate (DTD) 1072-53-5 C2H4O4S
ETHYLENE OXIDE (1,2-13C2) 84508-46-3 C2H4O 46.07 ETHYLENE-13C2 OXIDE; ETHYLENE OXIDE (1,2-13C2); ETHYLENE-13C2 OXIDE, 99 ATOM % 13C; ethylene oxide-13c2
ETHYLENE MALEIC ANHYDRIDE CO-POLYMER 9006-26-2 C18H18O9X2 378.33 2,5-furandione,polymerwithethene; ema1605; ethylene,polymerwithmaleicanhydride; maleicanhydride,polymerwithethylene; Polyethene,modigiedwithmaelicanhydride; polyethylenemaleicanhydridecopolymer; rpc1022; sholexet182
Ethylene glycol, nonyl alcohol, phthalic anhydride polymer 67891-71-8
Ethylene glycol, fumaric acid, rosin polymer 68152-55-6
ETHYLENE GLYCOL, [1,2-3H] 76550-74-8 C2H2O2T4 70.1 ETHYLENE GLYCOL, [1,2-3H]
Ethylene glycol monoricinoleate 106-17-2 C20H38O4 342.516 RICINOLEIC ACID 2-HYDROXYETHYL ESTER; ETHYLENE GLYCOL MONORICINOLEATE; 1,2-ETHANEDIOL MONORICINOLEATE; 2-hydroxyethyl ricinoleate; GLYCOL RICINOLEATE; 9-Octadecenoic acid, 12-hydroxy-, 2-hydroxyethyl ester, (9Z,12R)-
Ethylene glycol monoethyl ether acrylate 106-74-1 C7H12O3 144.17 2-ethoxy-ethanoacrylate; 2-Ethoxyethyl 2-propenoate; 2-ethoxyethyl-2-propenoate; 2-Ethoxyethylester kyseliny akrylove; 2-ethoxyethylesterkyselinyakrylove; 2-ethoxyethylesterkyselinyakrylove(czech); 2-Propenoic acid, 2-ethoxyethyl ester; 2-propenoicacid,2-
Ethylene glycol monobutyl ether laurate 109-37-5 C18H36O3 300.48 LAURIC ACID 2-BUTOXYETHYL ESTER; ETHYLENE GLYCOL MONOBUTYL ETHER LAURATE; BUTOXYETHYL DODECANOATE; BUTOXYETHYL LAURATE; 2-butoxyethyl laurate; Dodecanoic acid 2-butoxyethyl ester
Ethylene glycol dilaurate 624-04-4 C26H50O4 426.67 1,2-DILAUROYL ETHYLENE GLYCOL; 12:0 ETHYLENE GLYCOL; 12:0 EG; ETHYLENE DIGLYCOL DILAURATE; ETHYLENE DILAURATE; ETHYLENE GLYCOL DILAURATE; ETHYLENE LAURATE; GLYCOL LAURATE
Ethylene glycol diethyl ether 16484-86-9 C6H14O2 118.17 ETHYLENE GLYCOL DIETHYL ETHER; 1,2-Diethoxyethene; 1,2-Diethoxyethylene
Ethylene glycol dibenzoate 94-49-5 C16H14O4 270.28 ETHYLENE DIBENZOATE; ETHYLENE GLYCOL DIBENZOATE; GLYCOL DIBENZOATE; 1,2-BIS(BENZOYLOXY)ETHANE; 1,2-Ethanediol, dibenzoate; 2-(Benzoyloxy)ethyl benzoate; Benzoflex 998; Benzoflex e-60
ETHYLENE GLYCOL CHITIN 9056-32-0 0 glycolchitin; ETHYLENE GLYCOL CHITIN; CHITIN, ETHYLENE GLYCOL
Ethylene glycol bis[4-(2-fluorobenzoyl)phenyl] ether 216144-24-0 C28H20F2O4 458.45 ETHYLENE GLYCOL BIS[4-(2-FLUOROBENZOYL)PHENYL] ETHER; LABOTEST-BB LT00454834; Ethylene glycol bis4-(2-fluorobenzoyl)phenyl√ľ ether, 99%
Ethylene glycol bis-(monochloroacetate) 6941-69-1 C6H8Cl2O4 215.03 ETHYLENE GLYCOL DICHLOROACETATE; ETHYLENE GLYCOL BISCHLOROACETATE; ETHYLENE GLYCOL BIS(MONOCHLOROACETATE); CHLORO-ACETIC ACID 2-(2-CHLORO-ACETOXY)-ETHYL ESTER; IFLAB-BB F1983-0036; AKOS BC-3012; 1,2-BIS(CHLOROACETOXY)ETHANE; Acetic acid, chloro-, 1,2-etha
Ethylene diurea 54924-46-8
Ethylene diurea 1852-14-8 C4H10N4O2 146.148
Ethylene di(thiotosylate) 2225-23-2 C16H18O4S4 402.57 Ethylene di(thiotosylate); Ethylene Di(thiotosylate) [Protecting Reagent for Active Methylene]
Ethylene Brassylate 105-95-3 C15H26O4 270.37 1,1'-undecanedicarboxylicacid,esterwithethyleneglycol; 1,11-Undecanedicarboxylic acid, ester with ethylene glycol; 1,4-Dioxa-5,17-cyclo-heptadecandione; Astratone; Emeressence 1150; emeressence1150
Ethylene bis[1,3-dihydro-1,3-dioxoisobenzofuran-5-carboxylate] 1732-96-3 C20H10O10 410.29 Ethylene bis[1,3-dihydro-1,3-dioxoisobenzofuran-5-carboxylate]; Ethylene glycol bis(4-trimellitate anhydride)
Ethylene bis(tribromoacetate) 94159-39-4 C6H4Br6O4
Ethylene Bis Stearamide(EBS) 100-30-5 C38H76N2O2 593.0222
Ethylene Bis Stearamide EBS 84215-60-1 C46H91N5O4
ETHYLENE ACRYLATE 111802-12-1 C8H10O4 170.17
ETHYLENE (1,2-13C2) 51915-19-6 C2H4 30.07 ETHYLENE (1,2-13C2); ETHYLENE-13C2; ETHYLENE-13C2 99 ATOM % 13C; POLY(ETHYLENE-13C2), 99 ATOM % 13C; Ethene-13C2
ETHYLDOCOSAHEXAENOATE 81926-94-5 C24H36O2 356.54 (all-Z)-
ethyldiphenylphosphine oxide 1733-57-9 C14H15OP 230.24 AURORA KA-1563; ETHYLDIPHENYLPHOSPHINE OXIDE; DIPHENYLETHYLPHOSPHINE OXIDE; diphenylethyl-phosphineoxid; Phosphine oxide, ethyldiphenyl-; Ethyldiphenyl phosphine oxide, 98 %
Ethyldiphenylphosphinate 1733-55-7 C14H15O2P 246.24 ETHYLDIPHENYLPHOSPHINATE; Ethyldiphenylphosphinate, 98 %; Diphenylphosphinic acid ethyl ester
Ethyldinitrobenzene 31344-57-7 C8H8N2O4 196.16012 Ethyldinitrobenzene; 1-ethyl-2,3-dinitrobenzene; Benzene,ethyldinitro-; 31344-57-7; AC1MI1E7; SCHEMBL2480650
Ethyldimethyltetradecylammonium bromide 68527-84-4 C18H40BrN 350.42 ethyldimethyltetradecylammonium bromide; Alkyl(C12-C16) dimethylethyl ammonium bromide; 1-Tetradecanaminium, N-ethyl-N,N-dimethyl-, bromide; tetradecyl-N-ethyl-N,N-dimethylammonium bromide; Tetradecyldimethylethylammonium bromide; Tetradecylethyldimethyla
Ethyldimethylpropylammonium bis(trifluoromethylsulfonyl)imide 258273-77-7 396.37
ethyldimethyl[3-[(1-oxoisooctadecyl)amino]propyl]ammonium ethyl sulphate 67633-63-0 522.83
ethyldimethyl(octadecyl)ammonium ethyl sulphate 110-07-6 C24H53NO4S 451.74692 ethyldimethyl(octadecyl)ammonium ethyl sulphate; Ethyldimethyl(octadecyl)ammoniumethylsulfat; N,N-Dimethyl-N-ethyl-N-octadecylammonium ethosulfate
Ethyldienedione 20799-05-7 C19H24O2 284.4 ethyldienedione; D(-)-18-METHYL-ESTRA-4,9-DIENE-3,17-DIONE; METHYLESTRADIENEDIONE; D(1)-18-Ethyl-estra-4,9-diene-3,17-dione
ETHYL-D5-MALONIC ACID 66311-22-6 C5H3D5O4 137.15 ETHYL-D5-MALONIC ACID
ETHYL-D5-AMINE HYDROCHLORIDE 284474-81-3 C2H3ClD5N 86.58 ETHYL-D5-AMINE HCL; ETHYL-D5-AMINE HYDROCHLORIDE; ETHYL-D5-AMINE HYDROCHLORIDE, 99 ATOM % D; Ethyl-D5-amineCl
Ethyl-D5 alcohol-D anhydrous 1516-01-6 C2D6O
Ethylcarbamic acid phenylmethyl ester 65935-09-3 C10H13NO2 179.21572 Ethylcarbamic acid phenylmethyl ester
Ethylcarbamic acid phenyl ester 17576-39-5 C9H11NO2 165.18914 Ethylcarbamic acid phenyl ester; Ai3-27289; Carbamic acid, ethyl-, phenyl ester
ETHYLBUTYLNITROSAMINE 4549-44-4 C6H14N2O 130.19 ETHYLBUTYLNITROSAMINE; N-NITROSO-N-ETHYL BUTYLAMINE ISOPAC; N'-Ethyl-N-nitroso-n-butylamine; N-NITROSOETHYLBUTYLAMINE; N-ETHYL-N-BUTYL NITROSAMINE; N-NITROSO-N-ETHYLBUTYLAMINE
Ethylbenzyltoluidine 119-94-8 C16H19N 225.33 N-ETHYL-N-(M-TOLYL)BENZYLAMINE; N-ETHYL-N-BENZYL-M-TOLUIDINE; n-ethyl-n-(3-methyl phenyl)-benzenemethanamine; N-BENZYL-N-ETHYL-M-TOLUIDINE; 3-(N-Benzyl-N-ethylamino)methylbenzene; 3-(N-Benzyl-N-ethylamino)toluene; Benzenemethanamine, N-ethyl-N-(3-methylph
ethylbenzoate 43-89-0 C9H10O2 0 ETHYLBENZOATE;93-89-0;Benzoicacid,ethylester;Benzoicether;Ethylbenzenecarboxylate;ethylbenzoate
Ethylbenzhydramine 642-58-0 C19H25NO 283.40800
ETHYLBENZENE-2,3,4,5,6-D5 20302-26-5 C8H5D5 111.2 ETHYLBENZENE (RING-D5); ETHYLBENZENE-2,3,4,5,6-D5; ETHYLBENZENE-RING-D5, 97 ATOM % D; ETHYLBENZENE-D5, (RING-D5) 98 ATOM % D; Ethyl(benzene-D5); 1-Ethyl(2,3,4,5,6-2H5)benzene
ETHYLAMINE-N,N-D2 5852-45-9 C2H5D2N 47.1 ETHYLAMINE-N,N-D2; ETHYLAMINE-N,N-D2, 99 ATOM % D; Ethylamine-N,N-D2 (gas)
Ethylamine,N,N-dimethyl-, compd. with sulfur trioxide (1:1) (8CI) 26453-21-4 O3 S
Ethylamine hydrobromide 593-55-5 C2H8BrN 126.00 Ethanamine,hydrobromide; AMINOETHANE HYDROBROMIDE; ETHYLAMMONIUM BROMIDE; ETHYLAMINE HYDROBROMIDE; Ethylamine·hydrogen bromide; Ethylammonium hydrobromide
Ethylacetopyruvate95% 615-97-2 C7H10O4 158.1519 Ethylacetopyruvate95%
ETHYL-6-INDAZOLOLYL-ACETATE 887411-57-6 C12H12N2O3 232.24 ETHYL-6-INDAZOLOLYL-ACETATE; ethyl 3-(1H-indazol-6-yl)-3-oxopropanoate
Ethyl-6,6-dicarbethoxy-7-oxo-8-phthalimidopelargonate 95820-20-5 C25H31NO9 489.51494 ETHYL-6,6-DICARBETHOXY-7-OXO-8-PHTHALIMIDOPELARGONAT
ETHYL-6(S),7-ISOPROPYLIDENEDIOXY-HEPTANOATE 119392-31-3 C12H22O4 230.3 ETHYL-6(S),7-ISOPROPYLIDENEDIOXY-HEPTANOATE; ETHYL-6(R),7-ISOPROPYLIDENEDIOXY-HEPTANOATE
ETHYL-6(S),7-ISOPROPYLIDENEDIOXY-HEPT-4-ENOATE 119392-30-2 C12H20O4 228.28 ETHYL-6(S),7-ISOPROPYLIDENEDIOXY-HEPT-4-ENOATE
Ethyl cis-4-hexenoate 34495-73-3 C8H14O2 142.19556 ethyl cis-4-hexenoate
Ethyl cis-4-[(2-amino-4-chlorophenyl)amino]-3-hydroxypiperidine-1-carboxylate 83763-27-3 C14H20ClN3O3
ETHYL CIS-2-ISOTHIOCYANATO-1-CYCLOPENTANECARBOXYLATE, 97 311341-94-3 C9H13NO2S 199.273 ETHYL CIS-2-ISOTHIOCYANATO-1-CYCLOPENTANECARBOXYLATE, 97; Cyclopentanecarboxylic acid, 2-isothiocyanato-, ethyl ester, (1R,2S)-rel- (9CI)
ETHYL CIS-2-HYDROXY-1-CYCLOPENTANECARBOXYLATE 2315-21-1 C8H14O3 158.19 ETHYL CIS-2-HYDROXY-1-CYCLOPENTANECARBOXYLATE; Ethyl cis-2-hydroxy-1-cyclopentanecarboxylate,98%
Ethyl cis-2-hydroxy-1-cyclohexanecarboxylate 16179-44-5 C9H16O3 172.22
Ethyl cis-1,3,4,4a,5,9b-hexahydro-2H-pyrido[4,3-b]indole-2-carboxylate 199725-38-7 C14H18N2O2 246.30 ethyl cis-1,3,4,4a,5,9b-hexahydro-2h-pyrido[4,3-b]indole-2-carboxylate; cis-1,3,4,4a,5,9b-Hexahydro-2H-pyrido[4,3-b]indole-2-carboxylic acid ethyl ester; 1,3,4A,5,9B-HEXAHYDRO,ETHYL ESTER,2H-PYRIDO[4,3-B]INDOLE-2-CARBOXYLIC ACID; 2H-PYRIDO[4,3,B]INDOLE-2-
Ethyl Cholroformate 541-43-3
ethyl 5-(hydroxymethyl)isoxazole-3-carboxylate 123770-62-7 C7H9NO4 171.15 ETHYL 5-(HYDROXYMETHYL)ISOXAZOLE-3-CARBOXYLATE
ethyl 5-(hydroxymethyl)-1-phenyl-1H-pyrazole-3-carboxylate 40753-66-0 C13H14N2O3 246.26186;g/mol ethyl5-(hydroxymethyl)-1-phenyl-1H-pyrazole-3-carboxylate;40753-66-0;CTK8D4022;ZINC67175717;HE052585;TC-070080
ETHYL 5-(CHLOROSULFONYL)-3-FUROATE 256373-91-8 C7H7ClO5S 238.65 ethyl5-chlorosulfonylfuran-3-carboxylate; ethyl5-(chlorosulfonyl)-3-furoate; 256373-91-8; ethyl5-(chlorosulfonyl)furan-3-carboxylate; ETHYL5--3-FUROATE; SCHEMBL7612945
ethyl 5-(chloromethyl)-3-isoxazolecarboxylate 3209-40-3 C7H8ClNO3 189.59632 ethyl 5-(chloromethyl)-3-isoxazolecarboxylate
ETHYL 5-(BUT-3-ENYL)THIOPHENE-2-CARBOXYLATE 208337-82-0 C11H14O2S 210.29266;g/mol ethyl5-but-3-enylthiophene-2-carboxylate; ETHYL5-(BUT-3-ENYL)THIOPHENE-2-CARBOXYLATE; 208337-82-0; CTK4E5251; ZINC96330638; ETHYL5-THIOPHENE-2-CARBOXYLATE
ETHYL 5-(BROMOMETHYL)ISOXAZOLE-3-CARBOXYLATE 84654-29-5 C7H8BrNO3 234.05 ETHYL 5-(BROMOMETHYL)ISOXAZOLE-3-CARBOXYLATE
Ethyl 5-(benzyloxy)-1H-indole-2-carboxylate 37033-95-7 C18H17NO3 295.33 5-BENZYLOXY-2-CARBETHOXYINDOLE; 5-BENZYLOXYINDOLE-2-CARBOXYLIC ACID ETHYL ESTER; 5-BENZYLOXYINDOLE ETHYL-2-CARBOXYLATE; 5-(PHENYLMETHOXY)-1H-INDOLE-2-CARBOXYLIC ACID ETHYL ESTER; BUTTPARK 97\57-93; ETHYL 5-(BENZYLOXY)-1H-INDOLE-2-CARBOXYLATE
Ethanone,2-(1-methylethoxy)-1,2-diphenyl- 6652-28-4 C17H18 O2 254.32 ISOPROPYLBENZOIN ETHER; BENZOIN ISOPROPYL ETHER; ALPHA-ISOPROPOXY-ALPHA-PHENYLACETOPHENONE; 2-ISOPROPOXY-1,2-DIPHENYLETHANONE; 2-ISOPROPOXY-2-PHENYLACETOPHENONE; 2-(1-methylethoxy)-1,2-diphenyl-ethanon; 2-(1-methylethoxy)-1,2-diphenyl-Ethanone; 2-(1-methy
Ethanone,1-tricyclo[8.2.2.24,7]hexadeca-4,6,10,12,13,15-hexaen-5-yl- 10029-00-2 C18H18 O 250.33492;g/mol AC1MQRYF; AC1Q1JJI; SCHEMBL2440685; BMIQCMMQLWBYIU-UHFFFAOYSA-N; MolPort-001-826-573; ZINC3123047
Ethanone,1-cyclopropyl-, O-[3-[(1,1-dimethylethyl)amino]-2-hydroxypropyl]oxime, [R-(E)]-(9CI) 96479-87-7 C12H24 N2 O2
Ethanone,1-[4-methyl-2-[4-(trifluoromethyl)phenyl]-5-thiazolyl]- 447406-53-3 C13H10 F3 N O S 285.28481;g/mol 1-[4-methyl-2-[4-(trifluoromethyl)phenyl]-1,3-thiazol-5-yl]ethanone;447406-53-3;T6663510;1-[4-methyl-2-(4-trifluoromethylphenyl)thiazol-5-yl]ethanone;1-(4-METHYL-2-(4-(TRIFLUOROMETHYL)PHENYL)THIAZOL-5-YL)ETHANONE;SCHEMBL4462657
Ethanone,1-[4-[2-hydroxy-3-[(1-methylethyl)amino]propoxy]-3-(propoxymethyl)phenyl]- 104449-98-1 C18H29 N O4 323.4272
Ethanone,1-[4-(trans-4-ethylcyclohexyl)phenyl]- 260415-81-4 C16H22 O
Ethanone,1-[4-(5-fluoro-1,2-benzisoxazol-3-yl)-1-piperidinyl]- 84163-10-0 C14H15 F N2 O2 262.28000
Ethanone,1-[4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-pyridinyl]- 741709-58-0 C13H18 B N O3 0 2-ACETYLPYRIDINE-4-BORONIC ACID PINACOL ESTER; 1-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridin-2-yl)ethanone
Ethanone,1-[4-(2-phenylethynyl)phenyl]- 1942-31-0 C16H12 O 220.27 1-(4-PHENYLETHYNYL-PHENYL)-ETHANONE; 1-[4-(2-PHENYLETH-1-YNYL)PHENYL]ETHAN-1-ONE; AKOS BAR-2466; 4'-(PHENYLETHYNYL)ACETOPHENONE; 4-(PHENYLETHYNYL)ACETOPHENONE; 4-acetyldiphenylacetylene
Epimedium extract powder 151-50-1
Ethyl5-acetyloxyindole-2-carboxylate 31720-89-5
ethyl5-(2-chlorophenyl)oxazole-4-carboxylate 127919-26-0
ETHYL-5-(2-CHLOROPHENYL)-ISOXAZOLE-4-CARBOXYLATE 76344-89-3 C12H10ClNO3 251.67 ETHYL-5-(2-CHLOROPHENYL)-ISOXAZOLE-4-CARBOXYLATE
ETHYL-4-TRIFLUOROMETHYL PYRIMIDINE-5-CARBOXYLATE 187035-81-0 C8H7F3N2O2 220.15 ETHYL-4-TRIFLUOROMETHYL PYRIMIDINE-5-CARBOXYLATE
ETHYL-4-THIAZOLOYL-ACETATE 887411-81-6 C8H9NO3S 199.23 ETHYL-4-THIAZOLOYL-ACETATE
ETHYL-4-PIPERIDINOYL-ACETATE 90979-13-8 C10H17NO3 199.25 ETHYL-4-PIPERIDINOYL-ACETATE
ETHYL-4-PHENYL PYRIMIDINE-5-CARBOXYLATE 100724-16-1 C13H12N2O2 228.25 ETHYL-4-PHENYL PYRIMIDINE-5-CARBOXYLATE
ethyl4-methyl-2-morpholinopyrimidine-5-carboxylate 78318-44-2 C12H17N3O3 251.3
ethyl4-methyl-2-(methylsulfonyl)pyrimidine-5-carboxylate 509101-17-1 C9H11N2O4S- 243.26000
ETHYL4-METHYL-1H-IMIDAZOLE-2-CARBOXYLATE 40253-44-9 C7H10N2O2 154.1665;g/mol 40253-44-9;ethyl4-methyl-1H-imidazole-2-carboxylate;ethyl5-methyl-1H-imidazole-2-carboxylate;4-Methyl-1H-imidazole-2-carboxylicacidethylester;SCHEMBL2423817;CTK4I2734
ethyl4-hydroxy-2-morpholinopyrimidine-5-carboxylate 25693-41-8 C11H15N3O4 0 ETHYL 4-HYDROXY-2-MORPHOLINOPYRIMIDINE-5-CARBOXYLATE
ethyl4-hydroxy-2-(pyrrolidin-1-yl)pyrimidine-5-carboxylate 25693-42-9 C11H14N3O3- 236.24700
ethyl4-hydroxy-2-(piperidin-1-yl)pyrimidine-5-carboxylate 25693-43-0 C12H17N3O3 0 ETHYL 4-HYDROXY-2-(PIPERIDIN-1-YL)PYRIMIDINE-5-CARBOXYLATE
ETHYL-4-ETHYL-5-PYRIMIDINE CARBOXYLATE 110960-75-3 C9H12N2O2 180.2 ETHYL-4-ETHYL-5-PYRIMIDINE CARBOXYLATE
ethyl4-chloro-2-morpholinopyrimidine-5-carboxylate 34750-23-7 C11H14ClN3O3 0 ETHYL 4-CHLORO-2-MORPHOLINOPYRIMIDINE-5-CARBOXYLATE
ethyl4-chloro-2-(pyrrolidin-1-yl)pyrimidine-5-carboxylate 34750-25-9 C11H14ClN3O2 255.70076;g/mol ethyl4-chloro-2-pyrrolidin-1-ylpyrimidine-5-carboxylate; CTK8I3396
ethyl4-[2,4-diamino-6-[[3-(anilino)-2-chloropropyl]amino]pyrimidin-5-yl]diazenylbenzoate hydrochloride 10554-09-3 C22H26Cl2N8O2 505.4 g/mol
Ethyl-4(2-Phthalimido Ethoxy)Acetoacetate 88150-75-8 C16H17NO6 319.31 Ethyl-4(2-Phthalimido Ethoxy)Acetoacetate
Ethyl4-(2-(4-cyanophenylamino)pyrimidin-4-ylamino)-3,5-dimethylbenzoate 708254-90-4 C22H21N5O2 387.43400
Ethyl-3-thiopropionate 5466-06-8 C5H10O2S 134.2 3-Mercaptopropanoic acid ethyl ester; 3-mercapto-propanoicaciethylester; Ethyl 3-sulfanylpropanoate; Ethyl beta-mercaptopropionate; Propionic acid, 3-mercapto-, ethyl ester; FEMA 3677
ETHYL-3-PYRROLOYL-ACETATE 887411-89-4 C9H11NO3 181.19 ETHYL-3-PYRROLOYL-ACETATE
ETHYL-3-PHENYL PYRAZOLE-4-CARBOXYLATE 181867-24-3 C12H12N2O2 216.24 BUTTPARK 146\04-15; ETHYL-3-PHENYL PYRAZOLE-4-CARBOXYLATE; RARECHEM AL BI 0428
Ethyl3-MEthyl-2-Indolecarboxylate 26304-51-8 C12H13NO2 203.24 Ethyl3-methyl-1H-indole-2-carboxylate; 26304-51-8; ethyl3-methylindole-2-carboxylate; ETHYL3-METHYL-2-INDOLECARBOXYLATE; 20032-31-9; BAS01507320
ETHYL-3-METHYL-2-HEXENOATE 15677-00-6 C9H16O2 156.22 ETHYL-3-METHYL-2-HEXENOATE; Ethyl-3-Methyl-2-Hexenoate (3:1 mixture of E and Z isomers)
ETHYL-3-ETHYLPENTYLCARBINOL 19781-27-2 C10H22O 158.29 6-Ethyl-3-octanol;3-Octanol,6-ethyl-;6-ethyloctan-3-ol;19781-27-2;ETHYL-3-ETHYLPENTYLCARBINOL;NSC92785
Ethyl-3-chloropyrazine-2-carboxylate 655247-45-3 C7H7ClN2O2 186.6 ETHYL 3-CHLORO-PYRAZINE-2-CARBOXYLATE
ETHYL-3-(TRI-N-BUTYLTIN)PROPENOATE 128266-87-5 C17H34O2Sn 389.16 ETHYL-3-(TRI-N-BUTYLTIN)PROPENOATE
ETHYL-3-(P-CHLOROPHENYL)-4-PYRAZOLE CARBOXYLATE 58582-98-2 C12H11ClN2O2 250.68 5-(4-CHLORO-PHENYL)-1H-PYRAZOLE-4-CARBOXYLIC ACID ETHYL ESTER; ETHYL-3-(P-CHLOROPHENYL)-4-PYRAZOLE CARBOXYLATE
ETHYL3-(BENZYLAMINO)BUTANOATE 6335-80-4 C12H17NO2 0
ETHYL-3-(4-FORMYLPHENYL) BENZOATE 194367-78-7 C16H14O3 254.28 ETHYL-3-(4-FORMYLPHENYL) BENZOATE
Ethyl3-(4-chlorophenylthio)-2-cyano-3-(methylthio)acrylate 214330-97-9 C13H12ClNO2S2 313.82288 Ethyl3-(4-chlorophenylthio)-2-cyano-3-(methylthio)acrylate; Ethyl 3-(4-chlorophenylthio)-2-cyano-3-
Ethyl3-(4-bromophenylthio)-2-cyano-3-(methylthio)acrylate 214330-98-0 C13H12BrNO2S2 358.27388 Ethyl3-(4-bromophenylthio)-2-cyano-3-(methylthio)acrylate; Ethyl 3-(4-bromophenylthio)-2-cyano-3-
ethyl3-(4-bromophenyl)-1,2,4-oxadiazole-5-carboxylate 951626-15-6 C11H9BrN2O3 297.10500
Ethyl3-(3-(2-ethoxy-2-oxoethyl)-1-methyl-1H-indol-2-yl)propanoate 74120-22-2 C18H23NO4 317.38000
ETHYL-3-(2-CHLOROPHENYL)-PYRAZOLE-4-CARBOXYLATE 149740-12-5 C12H11ClN2O2 250.68 ETHYL-3-(2-CHLOROPHENYL)-PYRAZOLE-4-CARBOXYLATE
Ethyl-2-t-butoxy-2-carboxylamino-3-nitrobenzoate 136285-65-9 C14H18 N2 O6 310.30252;g/mol Ethyl-2-t-butoxy-2-carboxylamino-3-nitrobenzoate
ETHYL-2-PIPERIDINOYL-ACETATE 70883-14-6 C10H17NO3 199.25 ETHYL-2-PIPERIDINOYL-ACETATE
ethyl-2-phenylglycidate 19780-36-0 C11H12O3 192.21118 ethyl-2-phenylglycidate
Ethyl-2-phenyl-2-cyanobutylate 718-71-8 C13H15NO2 217.26 (R,S)-Ethylphenylcyano-aceticacidethylester; ETHYL ETHYLPHENYLCYANOACETATE; ethylphenylcyano-acetic acid ethyl ester; (r,s)-2-cyano-2-phenyl-butyric acid ethyl ester; Ethyl 2-Phenyl-2-cyanobutyl acid ester; 2-PHENYL-2-ETHYL-2-CYANOACETIC ACID ETHYL ESTER;
ethyl2-morpholino-4-(trifluoromethyl)pyrimidine-5-carboxylate 677706-89-7
ETHYL2-METHYLTHIO-4-PYRIMIDIN-ACETATE 582309-12-4 C9H12N2O2S 212.26878;g/mol ethyl2-(2-methylsulfanylpyrimidin-4-yl)acetate; 582309-12-4; ethyl2-(2-(methylthio)pyrimidin-4-yl)acetate; Ethyl2-(2-(methylthio)pyrimidin-4-yl)acetate; ETHYL2-METHYLTHIO-4-PYRIMIDIN-ACETATE; (2-Methylsulfanyl-pyrimidin-4-yl)-aceticacidethylester
ETHYL-2-METHYL-4-PROPYL-5-PYRIMIDINE CARBOXYLATE 127957-89-5 C11H16N2O2 208.26 ETHYL-2-METHYL-4-PROPYL-5-PYRIMIDINE CARBOXYLATE
ETHYL-2-METHYL-4-PHENYL-5-PYRIMIDINE CARBOXYLATE 127957-93-1 C14H14N2O2 242.27 ETHYL-2-METHYL-4-PHENYL-5-PYRIMIDINE CARBOXYLATE
ETHYL-2-METHYL-4-ISOPROPYL-5-PYRIMIDINE CARBOXYLATE 127957-90-8 C11H16N2O2 208.26 ETHYL-2-METHYL-4-ISOPROPYL-5-PYRIMIDINE CARBOXYLATE
Ethyl2-methyl-4H-furo[3,2-b]pyrrole-5-carboxylate 80709-78-0 C10H11NO3 193.19900
ETHYL-2-METHYL-4-ETHYL-5-PYRIMIDINE CARBOXYLATE 127957-88-4 C10H14N2O2 194.23 ETHYL-2-METHYL-4-ETHYL-5-PYRIMIDINE CARBOXYLATE
ETHYL-2-METHYL-4-(2-CHLOROPHENYL)-5-PYRIMIDINE CARBOXYLATE 162509-17-3 C14H13ClN2O2 276.72 ETHYL-2-METHYL-4-(2-CHLOROPHENYL)-5-PYRIMIDINE CARBOXYLATE; ETHYL-2-METHYL-4-(2-CHLOROPHENYL)-PYRIMIDINE-5-CARBOXYLATE
ETHYL-2-METHYL-4-(2-BROMOPHENYL)-PYRIMIDINE-5-CARBOXYLATE 311340-73-5 C14H13BrN2O2 321.17 ETHYL-2-METHYL-4-(2-BROMOPHENYL)-PYRIMIDINE-5-CARBOXYLATE
ETHYL-2-INDOLOYL-ACETATE 887411-77-0 C13H13NO3 0 ETHYL-2-INDOLOYL-ACETATE
ETHYL-2-ETHYL-4-METHYL-5-PYRIMIDINE CARBOXYLATE 99169-93-4 C10H14N2O2 194.23 ETHYL-2-ETHYL-4-METHYL-5-PYRIMIDINE CARBOXYLATE
Ethyl-2-chlorooxazole-4-carboxylate 4600081-18-9 C6H5BrClNO3 254.4658;g/mol ethyl2-bromo-5-chloro-1,3-oxazole-4-carboxylate;Ethyl2-bromo-5-chlorooxazole-4-carboxylate;4600081-18-9;ZINC72194435;AKOS015951130;RP29072
Ethyl-2-chloro-n-butanoate 7425-45-8 C6H11ClO2 150.60334 2-Chlorobutyric acid,ethyl ester; Ethyl-2-chloro-n-butanoate; Ethyl 2-chlorobutyrate
ETHYL-2-CHLORO-4-(TRIFLUOROMETHYL)OXAZOLE-5-CARBOXYLATE 78451-14-6 C7H5ClF3NO3 0 ETHYL-2-CHLORO-4-(TRIFLUOROMETHYL)OXAZOLE-5-CARBOXYLATE
Ethyl-2-bromo-tetradecanoic acid 14980-92-8
Ethyl-2-amino-benzo(b)thiophene-3-carboxylate 7311-95-7 C11H11NO2S 221.279
ethyl2-amino-5-isopropylthiazole-4-carboxylate 77505-83-0 C9H14N2O2S 214.28
ethyl2-amino-5-(4-chlorophenyl)thiazole-4-carboxylate 77505-89-6 C12H11ClN2O2S 282.75 ETHYL 2-AMINO-5-(4-CHLOROPHENYL)-4-THIAZOLECARBOXYLATE; Ethyl 2-amino-5-(4-chlorophenyl)thiazole-4-carboxylate
ethyl2-amino-5-(3-chlorophenyl)thiazole-4-carboxylate 77505-90-9 C12H11ClN2O2S 282.75
Ethyl-2-amino-4,5-diethoxybenzoate 460750-27-0 C13H19 N O4 253.29426;g/mol ethyl2-amino-4,5-diethoxybenzoate;460750-27-0;SCHEMBL1013314;CTK4I9149;VALSMHHGXJRDCC-UHFFFAOYSA-N;6681AH
ETHYL-2-[5-(4-NITROPHENYL)]-FUROYL-ACETATE 887411-65-6 C15H13NO6 303.27 ETHYL-2-[5-(4-NITROPHENYL)]-FUROYL-ACETATE
ETHYL-2-[5-(3-NITROPHENYL)]FUROYL-ACETATE 887411-69-0 C15H13NO6 303.27 ETHYL-2-[5-(3-NITROPHENYL)]FUROYL-ACETATE
ETHYL-2[5-(2-NITROPHENYL)]-FUROYL-ACETATE 887411-73-6 C15H13NO6 303.27 ETHYL-2[5-(2-NITROPHENYL)]-FUROYL-ACETATE
Ethyl-2,4-decadienoate 37549-74-9 0
Ethyl-2,4,5-trifluorobenzoylacetate 207226-37-7 C8H6F2 140.13 2,6-DIFLUOROSTYRENE; Benzene, 2-ethenyl-1,3-difluoro- (9CI)
ETHYL-2,2,2-D3-TRIPHENYLPHOSPHONIUM BROMIDE 1560-55-0 C20H17BrD3P 374.269046334 ETHYL-2,2,2-D3-TRIPHENYLPHOSPHONIUM BROMIDE
ethyl2-(piperidin-1-yl)-4-(trifluoromethyl)pyrimidine-5-carboxylate 187036-01-7 C13H15F3N3O2 302.27200
ethyl2-(methylthio)-4-(trifluoromethyl)pyrimidine-5-carboxylate 149771-12-0 C9H9F3N2O2S 266.24 ethyl2-methylsulfanyl-4-(trifluoromethyl)pyrimidine-5-carboxylate; 149771-12-0; Ethyl2-(methylthio)-4-(trifluoromethyl)pyrimidine-5-carboxylate; ethyl2-(methylsulfanyl)-4-(trifluoromethyl)pyrimidine-5-carboxylate; ETHYL2-(METHYLTHIO)-4-(TRIFLUOROMETHYL)PY
ethyl2-(2,5-dimethylpyrrolyl)acetate 5044-21-3 C10H15NO2 181.23 Ethyl 2,5-dimethylpyrrole-1-acetate
Ethyl-1-piperidinepropionate 19653-33-9 C10H19NO2 185.2634 Ethyl-1-piperidinepropionate; 1-Piperidinepropionic acid ethyl ester
ETHYL1-PHENYL-5-PHENYLAMINOIMIDAZOLE-4-CARBOXYLATE 68695-58-9 C18H17N3O2 307.34648 ETHYL1-PHENYL-5-PHENYLAMINOIMIDAZOLE-4-CARBOXYLATE
ETHYL-1-D1 ALCOHOL 1624-36-8 C2H5DO 47.074601778 ETHYL-1-D1 ALCOHOL
Ethyl-1-cyano-2-methylcyclohexanecarboxylate 5231-79-8
Ethyl1-butyl-2-piperidinecarbxylate 149442-04-6 C12H23NO2 0 Ethyl1-butyl-2-piperidinecarbxylate; 1-Butyl-2-ethoxycarbonylpiperidine; Ethyl 1-butyl-2-piperidinecarboxylate
ETHYL-1-BENZYL-4-PIPERINE CARBOXYLATE 59084-08-1 C21H25NO2 323.434 ETHYL-1-BENZYL-4-PIPERINE CARBOXYLATE
ETHYL-1-BENZYL-2,4-DIMETHYLPYRROLE-3-CARBOXYLATE 92977-40-7 C16H19NO2 257.33 ETHYL-1-BENZYL-2,4-DIMETHYLPYRROLE-3-CARBOXYLATE
ETHYL-1-13C-BENZENE 99 ATOM % 13C 287399-32-0 C8H10 107.174 ethylbenzene; Ethyl-1-13C-benzene; 287399-32-0; 578584_ALDRICH; ETHYL-1-13C-BENZENE99ATOM%13C
ethyl1-[2-(4-ethoxycarbonylphenoxy)ethyl]-4-phenylpiperidin-1-ium-4-carboxylate bromide 102895-60-3 C25H32BrNO5 506.429 g/mol
ETHYL-1,1-D2-METHYLAMINE 223459-63-0 C3H7D2N 61.122583556 ETHYL-1,1-D2-METHYLAMINE
ethyl-1,1'-biphenyl 40529-66-6 C14H14 182.26096
Ethyl1-(3-nitrobenzyl)piperdine2-carboxylate 148729-22-0
ethyl-[2-[2-[ethyl(dimethyl)azaniumyl]ethoxy]propyl]-dimethylazaniumdiiodide 63982-28-5 C13H32I2N2O 486.215 g/mol
Ethyl,3-(2-chloroanilino)-2-cyanoacrylate 64317-75-5 C12H11ClN2O2 250.68 ETHYL 3-(2-CHLOROANILINO)-2-CYANOACRYLATE
Ethyl, 2-isobutyl acetoacetate 1522-34-5
ethyl(methyl)ammonium chloride 624-60-2 95.57 n-methyl-ethanaminhydrochloride; N-METHYLETHYLAMINE HYDROCHLORIDE; N-ETHYLMETHYLAMINE HYDROCHLORIDE; ethyl(methyl)ammonium chloride; N-ETHYLMETHYLAMINE HCL; EthylmethylamineHCl; METHYLETHANAMINE HYDROCHLORIDE; Ethanamine, N-methyl-, hydrochloride
Ethyl-(8a'R)-8a'-methyl-6'-oxo-3',4',6',7',8',8a'-hexahydro-2'H-spiro[1,3-dioxolane-2,1'-naphthalene]-5'-carboxylate 1173666-35-7
ETHYL-(5S)-BENZOYLOXY 6-OXOHEXENOATE 82493-58-1 C15H18O5 278.3 ETHYL-(5S)-BENZOYLOXY 6-OXOHEXENOATE
Ethyl(5-Ethyl-2-pyridinyl)-1,1-D2-acetate 1189654-25-8 C11H13D2NO2 198.278443556 Ethyl(5-Ethyl-2-pyridinyl)-1,1-D2-acetate; (5-Ethyl-pyridin-2-yl)-acetic Acid-d2 Ethyl Ester; ((5-Ethyl-pyridin-2-yl)-D2-acetic Acid-D Ethyl Ester)
Ethyl(4-butyry-2,3-dichloro)phenoxyacetate 2777-51-7 0 Ethyl(4-butyry-2,3-dichloro)phenoxyacetate
ETHYL(3-PYRIDIN-3-YL-PHENYL)-ACETATE 134163-87-4 C15H15NO2 0 ETHYL(3-PYRIDIN-3-YL-PHENYL)-ACETATE
ETHYL-(3,4-DIMETHOXY-PHENYL)-AMINE 32953-13-2 C10H15NO2 181.23 ETHYL-(3,4-DIMETHOXY-PHENYL)-AMINE
ethyl(2S)-2-[[2-acetamido-3-[4-[bis(2-chloroethyl)amino]phenyl]propanoyl]amino]-4-methylpentanoate 3577-89-7 C23H35Cl2N3O4 488.448 g/mol
ETHYL-(2-PHENYLSULFOMETHYL)-ACRYLATE 89295-32-9 C12H14O4S 254.3 ETHYL-(2-PHENYLSULFOMETHYL)-ACRYLATE
ETHYL-(2-PHENYL-PROPYL)-AMINE 52497-69-5 C11H17N 163.26 ETHYL-(2-PHENYL-PROPYL)-AMINE
Ethyl(2-naphthyl)amine 2437-03-8 C12H13N 171.24 Ethyl-(2-Naphthyl)Amine; ethyl(2-naphthyl)amine; N-ethylnaphthalen-2-amine; N-Ethyl-2-naphthalenamine; N-Ethyl-2-naphtylamine; N-Ethylnaphthalene-2-amine
ethyl(2-hydroxyethyl)dimethylammonium chloride 19147-34-3 C6H16ClNO 153.65034 ethyl(2-hydroxyethyl)dimethylammonium chloride; Einecs 242-839-7
Ethyl(2-ethoxy-1-benzimidazole)-7-carboxylate 136285-67-1 C23H19N3O4 401.41 2-[[(2'-Cyano[1,1'-biphenyl]-4-yl)methyl]amino]-3-nitro-benzoic acid ethyl ester; Ethyl-2-[[(2'-cyanobiphenyl-4-yl)methyl]amino]-3-nitrobenzoate; Ethyl(2-ethoxy-1-benzimidazole)-7-carboxylate
ethyl(1R,3R)-3-(2,2-dichloroethenyl)-2,2-dimethylcyclopropane-1-carboxylate 60940-88-7 C10H14Cl2O2 237.123 g/mol
ETHYL(1-ACETYL-3-OXOPIPERAZIN-2-YL)ACETATE 104143-60-4 C10H16N2O4 0 ETHYL(1-ACETYL-3-OXOPIPERAZIN-2-YL)ACETATE
Ethyl thiazolidine-4-carboxylate 51977-21-0 C6H11NO2S 161.22 Ethylthiazolidine-4-carboxylate; 51977-21-0; ethyl1,3-thiazolidine-4-carboxylate; Ethyl(R)-thiazolidine-4-carboxylate; AC1L2V1P; AC1Q64NB
Ethyl tetrahydrofuran-3-carboxylate 139172-64-8 C7H12O3 144.16838 Ethyl tetrahydro-3-furoate; 3-Furancarboxylicacid,tetrahydro-,ethylester(9CI)
Ethyl tetrahydro-2-furoate 16874-34-3 C7H12O3 144.17 ETHYL TETRAHYDRO-2-FUROATE
ETHYL STEAROYLACETATE 7146-82-9 C22H42O3 354.57 3-OXOEICOSANIC ACID ETHYL ESTER; ETHYL STEAROYLACETATE; STEAROYLACETIC ACID ETHYL ESTER; ethyl 3-oxoicosanoate; 3-Oxoicosanoic acid ethyl ester; Octadecanoylacetic acid ethyl ester; Eicosanoic acid, 3-oxo-, ethyl ester; Einecs 230-456-8
ETHYL STAINS-ALL 3028-94-2 C31H29BrN2S2 573.61 ETHYL STAINS-ALL; 1-ethyl-2-[2-[(1-ethylnaphtho[1,2-d]thiazol-2(1H)-ylidene)methyl]-1-buten-1-yl]naphtho[1,2-d]thiazolium bromide; 1-ethyl-2-[3-(1-ethylnaphtho[1,2-d]thiazolin-2-ylidene]-2-; ETHYL STAINS-ALL, PURE; 2-[2-Ethyl-3-[1-ethylnaphtho[1,2-d]thiaz
Ethyl silicate 11099-06-2 C2H6O3Si 106.15 Silicic acid, ethyl ester; Ethyl polysilicate; Ethylpolysilikat; ETHYL SILICATE POLYMER; Ethyl Silicate 32; Ethyl Silicate 50
ETHYL SAFRANATE 35044-58-7 C12H18O2 194.27 RARECHEM AL BI 0783; 3-Cyclohexene-1-carboxylicacid,6,6-dimethyl-2-methylene-,ethylester; 6,6-dimethyl-2-methylene-3-cyclohexene-1-carboxylicaciethylester; ETHYL SAFRANATE; ETHYL-6,6-DIMETHYL-2-METHYLENECYCLOHEX-3-ENE CARBOXYLATE; 6,6-Dimethyl-2-methylene
Ethyl quinoline-8-carboxylate 25635-22-7 C12H11NO2 201.22 Ethyl8-quinolinecarboxylate; ethylquinoline-8-carboxylate; 25635-22-7; 8-Quinolinecarboxylicacid,ethylester; CCRIS6962; 8-Quinoline-carboxylicacidethylester
ETHYL PYRUVATE (3,3,3-D3) 66966-38-9 C5H5D3O3 119.13 ETHYL PYRUVATE (3,3,3-D3)
ETHYL PYRROLO[1,2-C]PYRIMIDINE-3-CARBOXYLATE 107407-80-7 C10H10N2O2 190.2 ETHYL PYRROLO[1,2-C]PYRIMIDINE-3-CARBOXYLATE; Ethylpyrrol[1,2-c]pyrimidine-3-carboxylate; ethyl pyrrolo[1,2-f]pyrimidine-3-carboxylate
ethyl pyrrolidine-1-propionate 6317-35-7 C9H17NO2 171.23678
ETHYL PROPYL DISULFIDE 30453-31-7 C5H12S2 136.28 1-(Ethyldisulfanyl)propane; Disulfide, ethyl propyl; Ethyl n-propyl disulphide; ETHYL PROPYL DISULFIDE; ETHYL PROPYL DISULPHIDE; FEMA 4041
Ethyl potassium malonate(KEM) 6148-64-17
Ethyl piperidinoacetylaminobenzoate 41653-21-8 C16H22N2O3 290.36 ethyl piperidinoacetylaminobenzoate; Sulcain; Sulcaine; 4-[(1-Piperidinylacetyl)amino]benzoic acid ethyl ester; 4-[(Piperidinoacetyl)amino]benzoic acid ethyl ester; Nichicaine
Ethyl piperidine-4-carboxylate hydrochloride 147636-76-8 C8H15NO2.HCl 193.67 ETHYL 4-PIPERIDINECARBOXYLATE HCL; ETHYL 4-PIPERIDINECARBOXYLATE HYDROCHLORIDE; ETHYL ISONIPECOTATE HYDROCHLORIDE; ETHYL PIPERIDINE-4-CARBOXYLATE HYDROCHLORIDE; PIPERIDINE-4-CARBOXYLIC ACID ETHYL ESTER HYDROCHLORIDE; Ethylpiperidine-4-carboxylate,HCl
Ethyl piperidine-4-carboxylate 11126-09-6
Ethyl Piperidine-3-carboxylate hydrochloride 4842-86-8 C8H16NO2Cl 193.67 Ethyl Piperidine-3-carboxylate hydrochloride
ethyl perfluorononanoate 30377-52-7 C11H5F17O2 492.13 HEPTADECAFLUORO-N-NONANOIC ACID ETHYL ESTER; ETHYL PERFLUORO-N-NONANOATE; ETHYL PERFLUORONONANOATE; ETHYL HEPTADECAFLUORO-N-NONANOATE; PERFLUORO-N-NONANOIC ACID ETHYL ESTER; ethyl perfluorononan-1-oate
ETHYL PERFLUORO-N-AMYL KETONE 383177-55-7 C8H5F11O 326.11 ETHYL PERFLUORO-N-AMYL KETONE; 1H,1H,1H,2H,2H-UNDECAFLUORO-3-OCTANONE; PERFLUORO-N-AMYL ETHYL KETONE; Ethyl Perfluoroamyl Ketone; Ethyl Undecafluoroamyl Ketone; Ethyl Undecafluoropentyl Ketone
ethyl perfluoroheptanoate 41430-70-0 C9H5F13O2 392.11 ETHYL PERFLUOROHEPTANOATE; Ethyl perfluoroheptanoate 98%; Ethylperfluoroheptanoate98%; Ethyl=tridecafluoroheptanoate
ethyl p-anisoylacetate 2881-83-6 C12H14O4 222.239 P-ANISOYLACETIC ACID ETHYL ESTER; MOBEE; 4-methoxy-beta-oxo-benzenepropanoicaciethylester; Benzenepropanoicacid,4-methoxy-.beta.-oxo-,ethylester; AKOS 228-23; 4-METHOXYBENZOYLACETIC ACID ETHYL ESTER; ETHYL P-ANISOYLACETATE; ETHYL 4-METHOXYBENZOYLACETATE
ETHYL OXO-(4-TRIFLUOROMETHYLPHENYL)ACETATE 73790-06-4 C11H9F3O3 246.18 ETHYL OXO-(4-TRIFLUOROMETHYLPHENYL)ACETATE; ETHYL 2-[4-(TRIFLUOROMETHYL)PHENYL]GLYOXYLATE; (4-TRIFLUOROMETHYLPHENYL)GLYOXYLIC ACID ETHYL ESTER; ethyl 2-oxo-2-[4-(trifluoromethyl)phenyl]acetate
ETHYL OXANILATE 1457-85-8 C10H11NO3 193.2 Acetic acid, oxo(phenylamino)-, ethyl ester; Ethyl anilino(oxo)acetate; ETHYL OXANILATE; ETHYL 2-ANILINO-2-OXOACETATE; Ethyl oxanilate,98+%; 2-(Phenylamino)glyoxylic acid ethyl ester
ETHYL omega-BROMOUNDECANOATE 5445-40-9 C13H25O2Br 293.25 ethyl 2-bromoundecanoate; 2-Bromoundecanoic acid ethyl ester
ethyl N-salicyloylanthranilate 18066-04-1 C16H15NO4 285.2946 ethyl N-salicyloylanthranilate; N-Salicyloylanthanilic acid ethyl ester; Einecs 241-973-3
ethyl non-2-enoate 17463-01-3 C11H20O2 184.2753 ethyl non-2-enoate; ethyl-2-nonenoate; 2-Nonenoic acid ethyl ester; Einecs 241-476-1; Nsc 250998
ethyl nitrobenzoate 54605-16-2 O2NC6H4COOC2H5 195.17206;g/mol ethyl2-nitrobenzoate;Ethyl2-nitrobenzoate;Ethylo-nitrobenzoate;610-34-4;ethylnitrobenzoate;Benzoicacid,o-nitro-,ethylester
ETHYL NIPECOTATE 71962-74-8 C8H15NO2 157.2102 LABOTEST-BB LT00159659; ETHYL NIPECOTINATE; ETHYL PIPERIDINE-3-CARBOXYLATE; 3-PIPERIDINECARBOXYLIC ACID ETHYL ESTER; PIPERIDINE-3-CARBOXYLIC ACID ETHYL ESTER; NIPECOTIC ACID ETHYL ESTER; NIPECOTINIC ACID ETHYL ESTER; RARECHEM AH CK 0179
ETHYL NICOTINATE-2,4,5,6-D4 66148-16-1 C8H5D4NO2 155.19 ETHYL NICOTINATE-2,4,5,6-D4; NICOTINIC ACID, ETHYL ESTER (2,4,5,6-D4); Ethyl Nicotinate-d4
Ethyl n-hexyl sulfide 7309-44-6 C8H18S 146.3
Ethyl N-Boc-piperidine-2-carboxylate 362703-48-8 C13H23NO4 257.33 Ethyl N-Boc-piperidine-2-carboxylate
Ethyl N-Boc-L-proline-4-ene 178172-26-4 C12H19NO4 241.28 1-O-tert-butyl2-O-ethyl(2S)-2,3-dihydropyrrole-1,2-dicarboxylate; 178172-26-4; (S)-1-tert-Butyl2-ethyl2,3-dihydro-1H-pyrrole-1,2-dicarboxylate; ETHYLN-BOC-L-PROLINE-4-ENE; (S)-1-Boc-2,3-dihydro-2-pyrrolecarboxylicacidethylester; (S)-2,3-Dihydro-pyrrole-1,
Ethyl N-acetyl-3,5-diiodo-L-tyrosinate 21959-36-4 C13H15I2NO4 503.07 N-Acetyl-3,5-diiodo-L-tyrosine ethyl ester; N-ACETYL-3,5-DIIODE-L-TYROSINE ETHYL ESTER; Ethyl N-acetyl-3,5-diiodo-L-tyrosinate
ethyl N-[2,5-difluoro-3-(trifluoromethyl)phenyl]carbamate 1799-76-4 C10H8F5NO2 269.16800
Ethyl N-[[5-methyl-2-(isopropyl)cyclohexyl]carbonyl]glycinate 39668-74-1 C15H27NO3 269.38 ethyl N-[[5-methyl-2-(isopropyl)cyclohexyl]carbonyl]glycinate; N-[[5-Methyl-2-(1-methylethyl)cyclohexyl]carbonyl]glycine ethyl ester
Ethyl N,N-dimethylaminomethylene acetoacetate 51145-57-4 C9H15NO3 185.22 2-ACETYL-3-DIMETHYLAMINO-ACRYLIC ACID ETHYL ESTER; ETHYL 2-ACETYL-3-(DIMETHYLAMINO)ACRYLATE; ETHYL N, N-DIMETHYLAMINOMETHYLENE ACETOACETATE; Ethyl (2E)-2-(dimethylaminomethylidene)-3-oxobutanoate; ethyl (2z)-2-acetyl-3-(dimethylamino)acrylate; Ethyl 2-[(d
Ethyl N,N-Dimethylaminoacrylate 20664-47-5
Ethyl N,N-diethyloxamate 5411-58-5 C8H15NO3 173.21 TIMTEC-BB SBB007933; Ethyl (diethylamino)(oxo)acetate; ETHYL DIETHYL OXAMATE; ETHYL N,N-DIETHYLOXAMATE; N,N-Diethyloxamic acid ethyl ester; NISTC5411585; N,N-Diethyloxamidic acid ethyl ester; 2-(diethylamino)-2-keto-acetic acid ethyl ester
ETHYL N-(O-ANISYL)CARBAMATE 35601-91-3
ETHYL N-(BENZYLOXYCARBONYL)-AMINOCYANOACETATE 3878-13-5 C13H14N2O4 262.26 ETHYL N-(BENZYLOXYCARBONYL)-AMINOCYANOACETATE; BENZYL (ETHOXYCARBONYL)(CYANO)METHYLCARBAMATE
ethyl N-(5-methylpyridin-2-yl)carbamate 41322-67-2 C9H12N2O2 0 ethyl N-(5-methylpyridin-2-yl)carbamate; Carbamic acid, (5-methyl-2-pyridinyl)-, ethylester
ethyl N-(2-dimethoxyphosphinothioylsulfanylethyl)carbamate 5840-95-9 C7H16NO4PS2 273.31 g/mol
Ethyl N-(2-butyl)glycinate 82560-46-1 C8H17NO2 159.22 ETHYL N-(2-BUTYL)GLYCINATE; N-(2-Butyl)glycine ethyl ester
ethyl N-(2-adamantyl)carbamate hydrochloride 74525-99-8 C13H22ClNO2 259.772 g/mol
ETHYL MORPHOLINOACETATE HYDROCHLORIDE 67067-94-1 C8H16ClNO3 209.67 ETHYL MORPHOLINOACETATE HYDROCHLORIDE; methyl morpholine-4-acetate hydrochloride; Activator 1532
Ethyl Morpholine-2-carboxylate 107904-06-3 C7H13NO3 159.18 ETHYL MORPHOLINE-2-CARBOXYLATE
ETHYL METHYLPHOSPHINATE 16391-07-4 C3H9O2P
Ethyl methylphenylglycidate 77-83-8 C12H14O3 206.24 2,3-epoxy-3-phenyl-butanoicaciethylester; 2,3-Epoxy-3-phenylbutyric acid, ethyl ester; 3-methyl-3-phenyl-oxiranecarboxylicacid,ethylester; 3-methyl-3-phenyl-oxiranecarboxylicacidethylester; 3-methyl-3-phenyl-oxiranecarboxylicaciethylester; alpha,beta-Epox
Ethyl methyldopate hydrochloride 2508-79-4 C12H17NO4.HCl 275.73 Ethyl methyldopate hydrochloride; Methyldopa ethyl hydrochloride
ethyl methylcarbamate 105-40-8 C4H9NO2 103.12 Carbamic acid, methyl-, ethyl ester; Ethylester kyseliny methylkarbaminove; ethylesterkyselinymethylkarbaminove; ethylmethylaminoformate; EthylN-methylcarbama+e; methyl-carbamicaciethylester
Ethyl methyl pent-2-ene-1,5-dioate 85508-07-2 C8H12O4 172.17848
ETHYL METHYL DISULFIDE 20333-39-5 C3H8S2 108.23 1-(Methyldisulfanyl)ethane; 2,3-Dithiapentane; Disulfide, ethyl methyl; Ethanesulfenothioic acid, methyl ester; METHYL ETHYL DISULFIDE; ETHYL METHYL DISULFIDE
ETHYL MESITYLACETATE 5460-08-2 C13H18O2
ETHYL MANDELATE 4358-88-7 C10H12O3 180.2 DL-ETHYL MANDELATE; DL-MANDELIC ACID ETHYL ESTER; ETHYL DL-MANDELATE; ETHYL ALPHA-HYDROXYPHENYLACETATE; ETHYL PHENYLGLYCOLATE; ETHYL MANDELATE; MANDELIC ACID ETHYL ESTER; DL-MANDELIC ACID ETHYL ESTER 93+%
ETHYL L-2-((TRIFLUOROMETHYLSULFONYL)OXY)PROPIONATE 77902-90-0 C6H9F3O5S 250.19300
Ethyl isoxazole-3-carboxylate 3209-70-9 C6H7NO3 141.125
Ethyl isothiazole-5-carboxylate 1001907-65-8 C6H7NO2S 157.19028;g/mol ethyl1,2-thiazole-5-carboxylate; Ethylisothiazole-5-carboxylate; 1001907-65-8; ZINC39325980; AKOS006305880; HE288558
Ethyl isopropyl thionocarbamate 18939-70-3 C6H13NOS 147.23852;g/mol Carbamothioicacid,(1-methylethyl)-,O-ethylester;18939-70-3;Isopropylcarbamothioicacid,O-ethylester;AC1NSLC1;Dow:Z-200;SCHEMBL1692040
ETHYL ISOPROPYL ETHER 625-54-7 C5H12O 88.15 2-ETHOXYPROPANE; ETHYL ISOPROPYL ETHER; (CH3)2CHOC2H5; 2-ethoxy-propan; Ether, ethyl isopropyl; ether,ethylisopropyl; Ethyl1-methylethylether; isopropylethylether
Ethyl isoferulate 155401-23-3
Ethyl isocyanopropionate 2920-8-3 127.14
Ethyl indole-7-carboxylate 205873-58-1 C11H11NO2 189.21 Ethyl indole-7-carboxylate; Indole-7-carboxylic acid ethyl ester
Ethyl indole-6-carboxylate 50820-64-9 C11H11NO2 189.21 6-Ethoxycarbonyl-1H-indole; 1H-indole-6-carboxylicacidethylester; Ethyl indole-6-carboxylate
Ethyl indole-5-carboxylate 32996-16-0 C11H11NO2 189.21 RARECHEM AL BI 0874; INDOLE-5-CARBOXYLIC ACID ETHYL ESTER; ETHYL INDOLE-5-CARBOXYLATE; 5-CARBETHOXYINDOLE; 1H-Indole-5-carboxylicacidethylester; INDOLE-5-CARBOXYLIC ACID ETHYL ESTER (I5CAEt)
Ethyl Imidazo[1,2-a]pyrimidine-3-carboxylate 64951-07-1 C9H9N3O2 191.1890 Ethyl Imidazo[1,2-a]pyrimidine-3-carboxylate
ETHYL HYDROGEN ETHYLPHOSPHONATE 7305-61-5 C4H11O3P 138.1 ethylphosphonicacidethylester; ethyl-phosphonicacimonoethylester; o-ethylethanephosphonicacid; o-ethylethylphosphonate; o-ethylhydrogenethylphosphonate; ETHYL HYDROGEN ETHYLPHOSPHONATE
ETHYL HYDROGEN DIMETHYLAMIDOPHOSPHATE, SODIUM SALT 2632-86-2 C4H11NNaO3P 175.1 GA ACID; ETHYL HYDROGEN DIMETHYLAMIDOPHOSPHATE, SODIUM SALT
Ethyl hydrazine carboxylate hydrochloride 25544-75-6 C3H9ClN2O2 140.56900
ETHYL HIPPURATE 1499-53-2 C11H13NO3 207.23 Benzoic amide, N-(ethoxycarbonyl)methyl-; Ethyl (benzoylamino)acetate; ETHYL 2-(BENZOYLAMINO)ACETATE; ETHYL HIPPURATE; BENZOYLGLYCINE ETHYL ESTER; 2-(benzoylamino)acetic acid ethyl ester; ethyl 2-(phenylcarbonylamino)ethanoate
Ethyl hexahydro-4,7-methanoindane-3a-carboxylate 80657-64-3
ethyl hex-2-enoate 1552-67-6 C8H14O2 142.19556 ethyl hex-2-enoate; ETHYLHEXENOATE; 2-Hexenoic acid ethyl ester
Ethyl Geranyl Ether 40267-72-9 C12H22O 182.3 GERANYL ETHYL ETHER; 3,7-DIMETHYL-2,6-OCTADIEN-1-ETHOXY; 1-ethoxy-3,7-dimethyl-2,6-octadiene; 1-ethoxy-3,7-dimethyl-6-octadiene; 6-Octadiene,1-ethoxy-3,7-dimethyl-2; ethylgeranylether; 1-ethoxy-3,7-dimethylocta-2,6-diene; 2,6-Octadiene, 1-ethoxy-3,7-dimet
ethyl furoate 1335-40-6 C7H8O3 140.1366 2-FUROIC ACID ETHYL ESTER; 2-FURANCARBOXYLIC ACID ETHYL ESTER; ETHYL FUROATE; ETHYL PYROMUCATE; ETHYL 2-FURANCARBOXYLATE; FURAN-2-CARBOXYLIC ACID ETHYL ESTER
Ethyl furaneol 27538-10-9 C7H10O3 142.15 2(or 5)-ethyl-4-hydroxy-5(or 2)-methyl- 3(2H)-furanone (Homofuraneol); 2-ethyl-4-hydroxy-5-methyl-3(2h)-furanon; 2-ethyl-4-hydroxy-5-methyl-3(2H)-furanone (homofuraneol); 3(2H)-Furanone, 2-ethyl-4-hydroxy-5-methyl-; 4-hydroxy-2- or 5-ethyl-5- and 2-methyl
Ethyl Formate 109-94-0
ETHYL ETHYNYL ETHER 977-80-0 C4H6O 70.09 ETHOXYACETYLENE
ETHYL ETHYLTHIOMETHYL SULFOXIDE 37032-07-8 C5H12OS2 152.27818
Ethyl esterpyrazolo[1,5-a]pyridine-2-carboxylic acid 80537-14-0 C10H10N2O2 190.2 ETHYL PYRAZOLO[1,5-A]PYRIDINE-2-CARBOXYLATE; PYRAZOLO[1,5-A]PYRIDINE-2-CARBOXYLIC ACID ETHYL ESTER
ETHYL ESTER OF PVM/MA COPOLYMER 50935-57-4 C9H14O5 202.20446;g/mol Ethylesterofpvm/MAcopolymer;2-Butenedioicacid(Z)-,monoethylester,polymerwithmethoxyethene;2-Butenedioicacid(2Z)-,monoethylester,polymerwithmethoxyethene;2-Butenedioicacid(Z)-,monoethylester,polymerwithmethoxyethane;25087-06-3;50935-57-4
ETHYL E-(DIHYDROFURAN-2-YLIDENE)ACETATE 99054-37-2 C8H12O3 156.18 ETHYL E-(DIHYDROFURAN-2-YLIDENE)ACETATE; [DIHYDRO-FURAN-(2E)-YLIDENE]-ACETIC ACID ETHYL ESTER
ETHYL DOCOSAHEXAENOATE 73310-11-9 C24H36O2 356.54144 ETHYL DOCOSAHEXAENOATE
Ethyl diphenylphosphono acetate 16139-79-0 C16H17O5P 320.28 Diphenylphosphonoacetic Acid Ethyl Ester
Ethyl diphenylphosphinite 719-80-2 C14H15OP 230.24 DiphenyethoxyPhosphine; PHOSPHINOUS ACID, DIPHENYL-, ETHYL ESTER; ETHYL DIPHENYLPHOSPHINITE; ETHOXYDIPHENYLPHOSPHINE; DIPHENYLETHOXY PHOSPHINE; DIPHENYLPHOSPHINOUS ACID ETHYL ESTER; Diphenylphosphinous acid ethyl ester~Ethoxydiphenylphosphine; ETHYL DIPHE
ethyl dihydrojasmonate 66332-99-8 C13H22O3 0
Ethyl diethoxyphosphinylformate 1474-78-8 C7H15O5P 210.17 Diethyl carbethoxyphosphonate; Diethyl ethoxycarbonylphosphonate; Ethyl diethoxyphosphinecarboxylate oxide; Formic acid, phosphono-, triethyl ester; phosphinecarboxylicacid,diethoxy-,ethylester,oxide; Triethyl carboxyphosphonate
Ethyl dichlorothiophosphate 14998-64-2 C2H5Cl2OPS 179.01 ETHYL PHOSPHORODICHLORIDOTHIONATE; ETHYL DICHLOROTHIOPHOSPHATE
Ethyl dibunate 5560-69-0 C20H28O3S 348.49952;g/mol ETHYLDIBUNATE;Neodyne;Tussets;Aethylidibunas;NDR304;Ethylisdibunas[INN-Latin]
Ethyl cyclopropaneacetate 53432-87-4 C7H12O2
ethyl cyclopentylideneacetate 1903-22-6 C9H14O2 154.20626 ethyl cyclopentylideneacetate; ethyl cyclopentylidene acetae; Cyclopentylideneacetic acid ethyl ester; 2-cyclopentylideneacetic acid ethyl ester; ethyl 2-cyclopentylideneethanoate
ETHYL CYCLOHEXYLIDENEACETATE 1552-92-7 C10H16O2 168.23 ETHYL CYCLOHEXYLIDENEACETATE; delta1,alpha-Cyclohexaneacetic acid, ethyl ester; Ethoxycarbonylmethylenecyclohexane; 2-Cyclohexylideneacetic acid ethyl ester; Cyclohexylideneacetic acid ethyl; ethyl 2-cyclohexylideneethanoate
Ethyl Cyclohex-3-ene-1-carboxylate 15111-56-5 C9H14O2 154.2080 Ethyl Cyclohex-3-ene-1-carboxylate
Ethyl cycloheptylideneacetate 1903-23-7 C11H18O2 168.23 CYCLOHEXYLIDENEACETIC ACID ETHYL ESTER; CYCLOHEPTYLIDENE-ACETIC ACID ETHYL ESTER; ETHYL CYCLOHEPTYLIDENEACETATE; ETHYL CYCLOHEXYLIDENEACETATE
Ethyl crotonate 10544-63-5 C6H10O2 114.1424 ETHYL TRANS-CROTONATE; ETHYL TRANS-2-BUTENOATE; ETHYL T2 BUTENOATE; FEMA 3486; CROTONIC ACID ETHYL ESTER; 2-Butenoicacid,ethylester
Ethyl crotonate 623-70-1 C6H10O2 114.14
Ethyl citronellate 26728-44-9 C12H22O2 198.3 ETHYL CITRONELLATE
ETHYL CITRAL 41448-29-7 C11H18O 166.26 ETHYL CITRAL; 3,7-dimethyl-2,6-nonadien-1-al; 3,7-Dimethyl-2,6-nonadienal; 3,7-dimethyl-6-nonadien-1-al; 3,7-dimethyl-6-nonadienal; 3,7-dimethylnona-2,6-dienal
ethyl cis-5-octenoate 72820-74-7 C10H18O2 170.24872 ethyl cis-5-octenoate
ETHYL CIS-4-PHENYL-2-BUTENOATE 559062-83-8 C12H14O2 190.24 ETHYL CIS-4-PHENYL-2-BUTENOATE
ETHYL CARBOXYETHYLSULPHONE 89211-36-9 C5H10O4S 166.2 ETHYL CARBOXYETHYLSULPHONE; UKRORGSYN-BB BBV-072363
Ethyl Carbitol Acrylate 7238-17-8 C9H16O4
Ethyl carbamate 51-76-8
ETHYL BUTYRYL LACTATE 71662-27-6 C9H16O4 188.22 ETHYL BUTYRYL LACTATE; 2-ethoxy-1-methyl-2-oxoethyl butyrate; Butanoic acid, 2-ethoxy-1-methyl-2-oxoethyl ester
Ethyl butyrimidate hydrochloride 2208-8-4 151.63 Ethyl butanimidate hydrochloride
ETHYL BROMOFLUOROACETATE 10-35-5 C4H6O2FBr 184.99 Ethylbromofluoroacetate; 401-55-8; BromofluoroaceticAcidEthylEster; ethyl2-bromo-2-fluoroacetate; ethyl-2-bromofluoroacetate; SBB070746
Ethyl bromoacetate-13C2 61898-49-5 168.99
Ethyl bromo-(4-fluoro-phenyl)-acetate 712-52-7 C10H10BrFO2 261.08 BROMO-(4-FLUORO-PHENYL)-ACETIC ACID ETHYL ESTER; ETHYL BROMO-(4-FLUORO-PHENYL)-ACETATE
Ethyl Bis(2,4-Dinitrophenyl) Acetate 5833-18-11
Ethyl adamantane-1-carboxylate 2094-73-7 C13H20O2 208.30 TRICYCLO[(3.3.1.1(3,7)]DECAN-1-CARBOXYLIC ACID ETHYL ESTER; AKOS BC-0667; 1-ADAMANTANECARBOXYLIC ACID ETHYL ESTER; Ethyl tricyclo[3.3.1.13,7]decane-1-carboxylate; ETHYL ADAMANTANE-1-CARBOXYLATE; ETHYL 1-ADAMANTANECARBOXYLATE
Ethyl acetylcarbamate 2597-54-8 C5H9NO3 131.13
Ethyl acetoacetate-4-13C 100548-44-5 131.13
Ethyl Acetamidomalonate 54681-67-3 C7H11NO5 189.17 2-(Acetylamino)propanedioic acid 1-ethyl ester
ETHYL ACETAMIDOETHANE THIOLATE 4396-62-7 C6H11NO2S 161.22 FEMA 4039; ETHYL ACETAMIDOETHANE THIOLATE; S-ETHYL-2-ACETYLAMINOETHANETHIOATE; N-ACETYLGLYCINE THIOLETHYL ESTER
ETHYL 9H-PERFLUORONONANOATE 1799-47-9 C11H6F16O2 474.14 ETHYL 9H-HEXADECAFLUORONONANOATE; ETHYL 9H-PERFLUORONONANOATE; DAIKIN S-5802; EthylHperfluorononanoate; Ethyl 9H-perfluorononanoate 97%; Ethyl9H-perfluorononanoate97%
ETHYL 9-FLUORENYLIDENEACETATE 27973-36-0 C17H14O2 250.29 ETHYL 9-FLUORENYLIDENEACETATE; 9-fluorenylideneacetic acid ethyl ester; dibenzofulvene-1-carboxylic acid ethyl ester
ETHYL 9-BROMONONANOATE 28598-81-4 C11H21BrO2 265.19 ETHYL 9-BROMONONANOATE; 9-BROMONONANOIC ACID ETHYL ESTER
ETHYL 8-OXO-8-(4-PENTYLOXYPHENYL)OCTANOATE 898757-85-2 C21H32O4 348.48 ETHYL 8-OXO-8-(4-PENTYLOXYPHENYL)OCTANOATE
ETHYL 8-METHYL-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE 220120-58-1 C12H15NO3 221.2524 ETHYL 8-METHYL-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE
ETHYL 8-CHLORO-4-OXO-4H-QUINOLIZINE-3-CARBOXLATE 139161-20-9 C12H10ClNO3 251.67 ETHYL 8-CHLORO-4-OXO-4H-QUINOLIZINE-3-CARBOXLATE; ETHYL 8-CHLORO-4-OXO-4H-QUINOLIZINE-3-CARBOXYLATE
ETHYL 8-CHLORO-1-ETHYL-4-OXO-4H-QUINOLIZINE-3-CARBOXYLATE 139179-03-6 C14H14ClNO3 279.72 ETHYL 8-CHLORO-1-ETHYL-4-OXO-4H-QUINOLIZINE-3-CARBOXYLATE
Ethyl 8-Chloro-1-Cyclopropy1-6,7-Difluoro-1,4-Dihydroquinoline-4-oxo-3-Carboxylate 99696-21-6 C15H12ClF2NO3 0 ethyl 8-chloro-1-cyclopropyl-6,7-difluoro-1,4-dihydroquinoline-4-oxo-3-carboxyla; Ethyl8-chloro-1-cyclopropyl-6,7-difluoro-1,4-dihydroquinoline-4-oxo-3-carboxylate; ETHYL 8-CHLORO-1-CYCLOPROPYL-6,7-DIFLUORO-4-OXO-1,4-DIHYDROQUINOLINE -3-CARBOXYLATE
Ethyl 8-bromoimidazo[1,2-a)pyridine-6-carboxylate 8-bromoimidazo[1,2-a)pyridine-6-carboxylate hydrochloride 957062-60-1 C10H10BrClN2O2 0 Ethyl 8-bromoimidazo[1,2-a)pyridine-6-carboxylate 8-bromoimidazo[1,2-a)pyridine-6-carboxylate hydrochloride; Ethyl 8-bromoimidazo[1,2-a]pyridine-6-carboxylate, hydrochloride
Ethyl 8-bromo-6-methyl-H-imidazo[1,2-a]pyridine-2-carboxylate 847446-55-3 C11H11BrN2O2 283.12 Ethyl 8-bromo-6-methylimidazo[1,2-a)pyridine-2-; Ethyl 8-bromo-6-methylimidazo[1,2-a]pyridine-2-carboxylate
Ethyl 8-bromo-6-chloroimidazo[1,2-a]pyridine-2-carboxylate 951884-22-3 C10H8BrClN2O2 303.54 Ethyl 8-Bromo-6-chloroimidazo[1,2-a]pyridine-2-carboxylate
ETHYL 8-BENZENESULFONYL-1,8-DIHYDRO-PYRROLO[2,3-B]INDOLE-2-CARBOXYLATE 182257-99-4 C19H16N2O4S 368.41 ETHYL 8-BENZENESULFONYL-1,8-DIHYDRO-PYRROLO[2,3-B]INDOLE-2-CARBOXYLATE
ETHYL 8-[2-(AZETIDINOMETHYL)PHENYL]-8-OXOOCTANOATE 898755-64-1 C20H29NO3 331.45 ETHYL 8-[2-(AZETIDINOMETHYL)PHENYL]-8-OXOOCTANOATE
ETHYL 8-(4-HEPTYLOXYPHENYL)-8-OXOOCTANOATE 898758-03-7 C23H36O4 376.53 ETHYL 8-(4-HEPTYLOXYPHENYL)-8-OXOOCTANOATE
ETHYL 7-METHYLQUINOLINE-3-CARBOXYLATE 481054-87-9 C13H13NO2 215.24782;g/mol ethyl7-methylquinoline-3-carboxylate;ETHYL7-METHYLQUINOLINE-3-CARBOXYLATE;481054-87-9;SCHEMBL8001650;MolPort-035-772-266;ZINC91692632
ETHYL 7-METHYL-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE 73268-46-9 C12H15NO3 221.2524 ETHYL 7-METHYL-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE
ETHYL 7-METHYL-2-(2-THIENYL)PYRAZOLO[1,5-A]PYRIMIDINE-6-CARBOXYLATE 162286-69-3 C14H13N3O2S 287.34 ETHYL 7-METHYL-2-(THIEN-2-YL)PYRAZOLO[1,5-A]-PYRIMIDINE-6-CARBOXYLATE; ETHYL 7-METHYL-2-(2-THIENYL)PYRAZOLO[1,5-A]PYRIMIDINE-6-CARBOXYLATE; BUTTPARK 94\04-24
ETHYL 7-METHOXY-1H-INDAZOLE-3-CARBOXYLATE 885278-98-8 C11H12N2O3 220.22 ETHYL 7-METHOXY-1H-INDAZOLE-3-CARBOXYLATE
ETHYL 7-FLUORO-5-(METHYLSULFONYL)-1H-INDOLE-2-CARBOXYLATE 849035-83-2 C12H12FNO4S 285.29 ETHYL 7-FLUORO-5-(METHYLSULFONYL)-1H-INDOLE-2-CARBOXYLATE; ETHYL 7-FLUORO-5-(METHYLSULPHONYL)-1H-INDOLE-2-CARBOXYLATE
ETHYL 7-ETHOXYIMIDAZO[2,1-B][1,3]BENZOTHIAZOLE-2-CARBOXYLATE 81022-06-2 C14H14N2O3S 290.34 ETHYL 7-ETHOXYIMIDAZO[2,1-B][1,3]BENZOTHIAZOLE-2-CARBOXYLATE; 7-ETHOXYIMIDAZO[2,1-B]BENZOTHIAZOLE-2-CARBOXYLIC ACID ETHYL ESTER
ETHYL 7-CYCLOPROPYL-7-OXOHEPTANOATE 898776-33-5 C12H20O3 212.29 ETHYL 7-CYCLOPROPYL-7-OXOHEPTANOATE
Ethyl 7-chloro-6-fluoro-1-(formylamino)-1,4-dihydro-4-oxoquinoline-3-carboxylate 88569-33-9 C13H10ClFN2O4
Ethyl 7-chloro-4-hydroxy-8-methylquinoline-3-carboxylate 5350-94-7 C13H12ClNO3 0 7-chloro-4-keto-8-methyl-1H-quinoline-3-carboxylic acid ethyl ester; ethyl 7-chloro-8-methyl-4-oxo-1H-quinoline-3-carboxylate
ethyl 7-chloro-4-hydroxy-3-quinolinecarboxylate 16600-22-9 C12H10 Cl N O3 237.64 7-CHLORO-4-HYDROXY-QUINOLINE-3-CARBOXYLIC ACID METHYL ESTER; Ethyl7-chloro-4-hydroxy-3-quinolinecarboxylate; Ethyl-7-chloro-1,4-dihydro-4-oxo-3-quinolinecarboxylate
ETHYL 7-CHLORO-3-OXO-3,4-DIHYDROQUINOXALINE-2-CARBOXYLATE 4829-67-8 C11H9ClN2O3 252.65 ETHYL 7-CHLORO-3-OXO-3,4-DIHYDROQUINOXALINE-2-CARBOXYLATE
ETHYL 7-CHLORO-1H-INDAZOLE-3-CARBOXYLATE 885278-59-1 C10H9ClN2O2 224.64 ETHYL 7-CHLORO-1H-INDAZOLE-3-CARBOXYLATE
Ethyl 7-bromo-1H-indazole-3-carboxylate 885279-56-1 C10H9BrN2O2 269.09 ETHYL 7-BROMO-1H-INDAZOLE-3-CARBOXYLATE
ETHYL 7-BENZYLOXY-1H-INDAZOLE-3-CARBOXYLATE 885278-92-2 C17H16N2O3 296.32 ETHYL 7-BENZYLOXY-1H-INDAZOLE-3-CARBOXYLATE
Ethyl 7-aminopyrazolo[1,5-a]pyrimidine-3-carboxylate 95+% 1196153-97-5 C9H10N4O2 206.20
ETHYL 7-AMINO-4-HYDROXYQUINOLINE-3-CARBOXYLATE 85368-92-9 C12H12N2O3 232.24 ETHYL 7-AMINO-4-HYDROXYQUINOLINE-3-CARBOXYLATE
ETHYL 7-AMINO[1,2,4]TRIAZOLO[1,5-A]PYRIMIDINE-6-CARBOXYLATE 92673-40-0 C8H9N5O2 207.19 ETHYL 7-AMINO[1,2,4]TRIAZOLO[1,5-A]PYRIMIDINE-6-CARBOXYLATE; Albb-005483
ETHYL 7-ACETOXYCOUMARIN-3-CARBOXYLATE 13209-77-3 C14H12O6 276.24 AURORA 20137; ETHYL 7-ACETOXYCOUMARIN-3-CARBOXYLATE
ETHYL 7,7-DIMETHYL-5-OXO-5,6,7,8-TETRAHYDROQUINOLINE-3-CARBOXYLATE 106944-52-9 C14H17NO3 247.28968 ETHYL 7,7-DIMETHYL-5-OXO-5,6,7,8-TETRAHYDROQUINOLINE-3-CARBOXYLATE
Ethyl 7-(allyloxy)-4-oxo-8-propyl-4H-chromene-2-carboxylate 248595-13-3 C18H20O5 316.35 ETHYL 7-(ALLYLOXY)-4-OXO-8-PROPYL-4H-CHROMENE-2-CARBOXYLATE
ETHYL 7-(3,4-DIMETHYLPHENYL)-7-OXOHEPTANOATE 898793-12-9 C17H24O3 276.37 ETHYL 7-(3,4-DIMETHYLPHENYL)-7-OXOHEPTANOATE
ETHYL 7-(2-ETHOXYPHENYL)-7-OXOHEPTANOATE 898757-45-4 C17H24O4 292.37 ETHYL 7-(2-ETHOXYPHENYL)-7-OXOHEPTANOATE
ETHYL 7-(2-CHLORO-3-PYRIDYL)-7-OXOHEPTANOATE 890100-59-1 C14H18ClNO3 283.75 ETHYL 7-(2-CHLORO-3-PYRIDYL)-7-OXOHEPTANOATE
ETHYL 7-(2,5-DIMETHOXYPHENYL)-7-OXOHEPTANOATE 898758-35-5 C17H24O5 308.37 ETHYL 7-(2,5-DIMETHOXYPHENYL)-7-OXOHEPTANOATE
Ethyl 6-oxo-6-(3-thienyl )hexanoate 333355-34-3 C12H16O3S 240.32
ethyl 6-nitrobenzo[d]oxazole-2-carboxylate 58758-41-1
ETHYL 6-NITRO-1H-INDOLE-2-CARBOXYLATE 16792-45-3 C11H10N2O4 234.21 ETHYL 6-NITRO-1H-INDOLE-2-CARBOXYLATE; ETHYL 6-NITROINDOLE-2-CARBOXYLATE; 6-Nitro-1H-indole-2-carboxylic acid ethyl ester
Ethyl 6-Methyl-5-Nitrobenzo[b]thiophene-2-Carboxylate 159730-73-1 C12H11NO4S 265.29
ETHYL 6-METHYL-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE 176383-56-5 C12H15NO3 221.2524 ETHYL 6-METHYL-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE
ETHYL 6-METHOXY-7-METHYL-6H-[1,2,5]OXADIAZOLO[3,4-E]INDOLE-8-CARBOXYLATE 306935-65-9 C13H13N3O4 275.26 ETHYL 6-METHOXY-7-METHYL-6H-1,2,5-OXADIAZOLO[3,4-E]INDOL-8-CARBOXYLATE; ETHYL 6-METHOXY-7-METHYL-6H-[1,2,5]OXADIAZOLO[3,4-E]INDOLE-8-CARBOXYLATE
ETHYL 6-METHOXY-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE 68281-50-5 C12H15NO4 237.2518 ETHYL 6-METHOXY-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE
Ethyl 6-Methoxy-1,2-Benzisoxazole-3-Carboxylate 57764-51-9 C11H11NO4 221.21 Ethyl 6-methoxy-1,2-benzisoxazole-3-carboxylate; Ethyl 6-methoxybenzo[d]isoxazole-3-carboxylate; 6-Methoxy-1,2-benzisoxazole-3-carboxylic acid ethyl ester
ETHYL 6-KETO-7-OCTENOATE 50628-92-7 C10H16O3 184.23 ETHYL 6-KETO-7-OCTENOATE
ETHYL 6-IODO-4-OXO-4H-CHROMENE-2-CARBOXYLATE 35204-44-5 C12H9IO4 344.1 ETHYL 6-IODO-4-OXO-4H-CHROMENE-2-CARBOXYLATE
ETHYL 6-HYDROXY-7-METHYL-6H-[1,2,5]OXADIAZOLO[3,4-E]INDOLE-8-CARBOXYLATE 159325-86-7 C12H11N3O4 261.23 ETHYL 6-HYDROXY-7-METHYL-6H-[1,2,5]OXADIAZOLO[3,4-E]INDOLE-8-CARBOXYLATE; Ethyl 6-hydroxy-7-methyl-6H-[1,2,5]oxadiazol[3,4-e]indole-8-carboxylate
Ethyl 6-fluoro-4-hydroxyquinoline-2-carboxylate 16377-62-1 C12H10FNO3 0 Ethyl 6-fluoro-4-hydroxyquinoline-2-carboxylate; Ethyl 6-fluoro-4-oxo-1,4-dihydroquinoline-2-carboxylate
Ethyl 6-fluoro-3,4-dihydro-2H-1,4-benzoxazine-2-carboxylate 220120-59-2 C11H12FNO3 225.2162832 ETHYL 6-FLUORO-3,4-DIHYDRO-2H-1,4-BENZOXAZINE-2-CARBOXYLATE
Ethyl 6-fluoro-1-methyl-4-oxo-7-(1-piprazinyl)-4H-[1,3]thiazeto[3,2-a]quinoline-3-carboxylate 113028-17-4 C18H20FN3O3S 377.43 ethyl 6-fluoro-1-methyl-4-oxo-7-(1-piprazinyl)-4h-[1,3]thiazeto[3,2-a]quinoline-3-carboxylate; 6-FLUORO-1-METHYL-4-OXO-7(1-PIPERAZINYL)-4H-(1,3)THIAZETO(3,2-A)QUINOLINE-3-CARBOYLIC ACID ETHYL ESTER; PRULIFLOXACIN INTERMEDIATE 2; ETHYL 6-FLUORO-1-METHYL-4-
Ethyl 6-fluoro-1H-indazole-3-carboxylate 885279-30-1 C10H9FN2O2 208.19 ETHYL 6-FLUORO-1H-INDAZOLE-3-CARBOXYLATE
ethyl 6-cyclopropyl -6-oxohexanoate 898776-30-2 C11H18O3 198.26431
Ethyl 6-cyano-1H-indazole-3-carboxylate 885279-19-6 C11H9N3O2 215.21 ETHYL 6-CYANO-1H-INDAZOLE-3-CARBOXYLATE
Ethyl 6-chloro-5-nitronicotinate 171876-22-5 C8H7ClN2O4 230.61
ETHYL 6-CHLORO-4-HYDROXYQUINOLINE-3-CARBOXYLATE 70271-77-1 C12H10ClNO3 251.67 6-CHLORO-4-HYDROXY-QUINOLINE-3-CARBOXYLIC ACID ETHYL ESTER; BUTTPARK 18\09-65; ETHYL 6-CHLORO-4-HYDROXY-3-QUINOLINECARBOXYLATE; ETHYL 6-CHLORO-4-HYDROXYQUINOLINE-3-CARBOXYLATE
Ethyl 6-chloro-1H-pyrrolo[3,2-b]pyridine-5-carboxylate 872355-69-6 C10H9ClN2O2 224.64
Ethyl 6-bromopyrrolo[1,2-c]pyrimidine-3-carboxylate 588720-12-1 C10H9BrN2O2 269.09 ethyl 6-bromoH-pyrrolo[1,2-f]pyrimidine-3-carboxylate; Ethyl 6-bromopyrrolo[1,2-f]pyrimidine-3-carboxylate; Ethyl 6-bromo-1H-pyrrolo[1,2-f]pyrimidine-3-carboxylate; Ethyl 6-bromopyrrolo[1,2-c]pyrimidine-3-carboxylate
Ethyl 6-bromocoumarin-3-carboxylate 2199-90-8 C12H9BrO4 297.10 6-Bromocoumarin-3-carboxylicAcidEthylEster
Ethyl 6-Bromobenzoisothiazole-3-Carboxylate 858671-74-6 C10H8NO2BrS 286.14 6-Bromo-1,2-benzisothiazole-3-carboxylic acid ethyl ester; Ethyl 6-bromobenzo[d]isothiazole-3-carboxylate
Ethyl 6-bromo-8-chloro-4-hydroxy-quinoline-3-carboxylate 217316-19-3 C12H9BrClNO3 330.56 ETHYL 6-BROMO-8-CHLORO-4-HYDROXY-QUINOLINE-3-CARBOXYLATE
Ethyl 6-bromo-4-chloroquinoline-3-carboxylate 206257-39-8 C12H9BrClNO2 314.56 6-Bromo-4-chloroquinoline-3-carboxylic acid ethyl ester; Ethyl 6-bromo-4-chloro-3-quinolinecarboxylate
ETHYL 6-BROMO-4-CHLORO-7-METHOXYQUINOLINE-3-CARBOXYLATE 476194-45-3 C13H11BrClNO3 344.59 ETHYL 6-BROMO-4-CHLORO-7-METHOXYQUINOLINE-3-CARBOXYLATE
Ethyl 6-bromo-2-methylquinoline-4-carboxylate 62482-30-8 C13H12BrNO2 294.14 ETHYL 6-BROMO-2-METHYLQUINOLINE-4-CARBOXYLATE
Ethyl 6-bromo-1H-pyrrolo[2,3-b]pyridine-2-carboxylate 577711-94-5 C10H9BrN2O2 269.1
Ethyl 5-amino-1-(4-bromophenyl)-1H-pyrazole-4-carboxylate 138907-71-8 C12H12BrN3O2 310.15 SALOR-INT L251496-1EA; ETHYL 5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOLE-4-CARBOXYLATE; BUTTPARK 87\09-21; 5-AMINO-1-(4-BROMO-PHENYL)-1H-PYRAZOLE-4-CARBOXYLIC ACID ETHYL ESTER
ETHYL 5-AMINO-1-(3-NITROPHENYL)PYRAZOLE-4-CARBOXYLATE 16459-34-0 C12H12N4O4 276.25 ETHYL 5-AMINO-1-(3-NITROPHENYL)PYRAZOLE-4-CARBOXYLATE
ethyl 5-amino-1-(2-hydroxyethyl)-1H-pyrazole-4-carboxylate 58046-49-4 C8H13N3O3 199.21 5-Amino-1-(2-hydroxyethyl)-1H-pyrazole-4-carboxylic acid ethyl ester; Ethyl 5-amino-1-(2-hydroxyethyl)pyrazole-4-carboxylate
ETHYL 5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOLE-4-CARBOXYLATE 618070-65-8 C12H12FN3O2 249.24 BUTTPARK 34\09-37; ETHYL 5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOLE-4-CARBOXYLATE; SALOR-INT L251526-1EA; OTAVA-BB 1218869; VITAS-BB TBB010286
Ethyl 5-amino-1-(2,5-difluorophenyl)pyrazole-4-carboxylate 138907-69-4 C12H11F2N3O2 267.23 ETHYL 5-AMINO-1-(2,5-DIFLUOROPHENYL)PYRAZOLE-4-CARBOXYLATE
ethyl 5-allyl-3-methoxysalicylate 7152-89-8 C13H16O4 0 2-Hydroxy-3-methoxy-5-(2-propenyl)benzoic acid ethyl ester
Ethyl 5-acetyl-2-ethoxybenzoate 216143-90-7 C13H16O4 236.26 ETHYL 5-ACETYL-2-ETHOXYBENZOATE; 4-Ethoxy-3-ethoxycarbonyl acetophenone
Ethyl 5-acetamido-4-cyano-3-methylthenoate 23903-49-3 C11H12N2O3S 252.29 g/mol
Ethyl 5-[5-acetamido-2-methoxy-4-[(5-nitrothiazol-2-yl)azo]phenyl]-9-oxo-2,8,10-trioxa-5-azadodecanoate 73275-65-7 C22H28N6O10S
ETHYL 5-[(3R)-4-AMINO-3-HYDROXYBUTYL]THIOPHENE-2-CARBOXYLATE 208337-84-2 C11H17NO3S 243.32258;g/mol ethyl5-[(3R)-4-amino-3-hydroxybutyl]thiophene-2-carboxylate; 208337-84-2; ETHYL5-[(3R)-4-AMINO-3-HYDROXYBUTYL]THIOPHENE-2-CARBOXYLATE; CTK4E5253; ZINC34434467; ETHYL5-[-4-AMINO-3-HYDROXYBUTYL]THIOPHENE-2-CARBOXYLATE
ETHYL 5-[(3R)-3,4-DIHYDROXYBUTYL]THIOPHENE-2-CARBOXYLATE 208337-83-1 C11H16O4S 244.30734;g/mol ethyl5-[(3R)-3,4-dihydroxybutyl]thiophene-2-carboxylate; 208337-83-1; ETHYL5-[(3R)-3,4-DIHYDROXYBUTYL]THIOPHENE-2-CARBOXYLATE; CTK4E5252
Ethyl 5,6-difluoro-1H-indazole-3-carboxylate 885279-04-9 C10H8F2N2O2 226.18 ETHYL 5,6-DIFLUORO-1H-INDAZOLE-3-CARBOXYLATE
Ethyl 5,6-dichloro-1H-indazole-3-carboxylate 885278-50-2 C10H8Cl2N2O2 259.09 ETHYL 5,6-DICHLORO-1H-INDAZOLE-3-CARBOXYLATE
ETHYL 5,6,7,8-TETRAHYDROIMIDAZO[1,2-A]PYRAZINE-2-CARBOXYLATE DIHYDROCHLORIDE HEMIHYDRATE 892502-00-0 C9H13N3O2.2ClH.H2O 286.157 ETHYL 5,6,7,8-TETRAHYDROIMIDAZO[1,2-A]PYRAZINE-2-CARBOXYLATE DIHYDROCHLORIDE HEMIHYDRATE
ETHYL 5-(4-METHOXYPHENYL)ISOXAZOLE-3-CARBOXYLATE 376623-69-7 C13H13NO4 247.25 ETHYL 5-(4-METHOXYPHENYL)ISOXAZOLE-3-CARBOXYLATE; 5-(4-METHOXYPHENYL)-3-ISOXAZOLECARBOXYLIC ACID ETHYL ESTER; 5-(4-METHOXY-PHENYL)-ISOXAZOLE-3-CARBOXYLIC ACID ETHYL ESTER
ETHYL 5-(4-METHOXYPHENYL)-2-THIOPHENECARBOXYLATE 13858-71-4 C14H14O3S 262.32 RARECHEM AK MA K023; ETHYL 5-(4-METHOXYPHENYL)-2-THIOPHENECARBOXYLATE; ETHYL 5-(4-METHOXYPHENYL)THIOPHENE-2-CARBOXYLATE
ethyl 5-(4-hydroxyphenyl)pentanoate 154044-13-0 C13H18O3 222.28 Ethyl 5-(4-hydroxyphenyl)pentanoate; 4-Hydroxy-benzenepentanoic acid ethyl ester
ETHYL 5-(4-FLUOROPHENYL)ISOXAZOLE-3-CARBOXYLATE 377052-00-1 C12H10FNO3 235.21 ETHYL 5-(4-FLUOROPHENYL)ISOXAZOLE-3-CARBOXYLATE; 5-(4-FLUOROPHENYL)-3-ISOXAZOLECARBOXYLIC ACID ETHYL ESTER; 5-(4-FLUORO-PHENYL)-ISOXAZOLE-3-CARBOXYLIC ACID ETHYL ESTER
Ethyl 5-(4-chlorophenyl)oxazole-4-carboxylate 127919-28-2 C12H10ClNO3 251.67 Ethyl 5-(4-chlorophenyl)oxazole-4-carboxylate
ETHYL 5-(4-CHLOROPHENYL)-2-(TRIFLUOROMETHYL)-3-FUROATE 175276-59-2 C14H10ClF3O3 318.68 ETHYL 5-(4-CHLOROPHENYL)-2-(TRIFLUOROMETHYL)-3-FUROATE; BUTTPARK 147\50-37; Ethyl 5-(4-chlorophenyl)-2-(trifluoromethyl)-3-furoate 97%; Ethyl5-(4-chlorophenyl)-2-(trifluoromethyl)-3-furoate97%
ETHYL 5-(3-OXOCYCLOHEXYL)-2-THIOPHENECARBOXYLATE 909421-70-1 C13H16O3S 252.33 ETHYL 5-(3-OXOCYCLOHEXYL)-2-THIOPHENECARBOXYLATE
ethyl 5-(3-hydroxyphenyl)pentanoate 143536-52-1 C13H18O3 222.28 Ethyl 5-(3-hydroxyphenyl)pentanoate; 3-Hydroxy-benzenepentanoic acid ethyl ester
ETHYL 5-(2-METHOXYPHENYL)-5-OXOPENTANOATE 124524-69-2 C14H18O4 250.29 ETHYL 5-(2-METHOXYPHENYL)-5-OXOPENTANOATE; ETHYL 5-(2-METHOXYPHENYL)-5-OXOVALERATE
ETHYL 5-(2-CHLORO-3-PYRIDYL)-5-OXOVALERATE 890100-55-7 C12H14ClNO3 255.7 ETHYL 5-(2-CHLORO-3-PYRIDYL)-5-OXOVALERATE
ETHYL 5-(2-ACETOXYPHENYL)-5-OXOVALERATE 898758-73-1 C15H18O5 278.3 ETHYL 5-(2-ACETOXYPHENYL)-5-OXOVALERATE
Ethyl 5-(2,4-dichlorophenyl)oxazole-4-carboxylate 254749-13-8 C12H9Cl2NO3 0 Ethyl 5-(2,4-dichlorophenyl)oxazole-4-carboxylate
ETHYL 5-(2,4-DICHLOROPHENYL)ISOXAZOLE-3-CARBOXYLATE 159427-17-5 C12H9Cl2NO3 286.11 ETHYL 5-(2,4-DICHLOROPHENYL)ISOXAZOLE-3-CARBOXYLATE; 5-(2, 4-DICHLOROPHENYL)-ISOXAZOLE-3-CARBOXYLIC ACID ETHYL ESTER; 5-(2,4-DICHLOROPHENYL)-3-ISOXAZOLECARBOXYLIC ACID ETHYL ESTER
Ethyl 5-(2,3-dichlorophenyl)oxazole-4-carboxylate 951885-31-7 C12H9Cl2NO3 286.10 Ethyl 5-(2,3-dichlorophenyl)oxazole-4-carboxylate
ETHYL 5-(1H-PYRAZOL-3-YL)ISOXAZOLE-3-CARBOXYLATE 264226-03-1 C9H9N3O3 207.18606 ETHYL 5-(1H-PYRAZOL-3-YL)ISOXAZOLE-3-CARBOXYLATE
ethyl 4-tert-butoxy-3-oxobutanoate 67354-35-2 C10H18O4 202.25
ETHYL 4-PYRIDIN-4-YL-1H-PYRROLE-3-CARBOXYLATE 197774-66-6 C12H12N2O2 216.23588 ETHYL 4-PYRIDIN-4-YL-1H-PYRROLE-3-CARBOXYLATE
ETHYL 4-PHENYLSULFANYLBENZOATE 10129-07-4 C15H14O2S 0 ETHYL 4-PHENYLSULFANYLBENZOATE
Ethyl 4-Phenylpyrrole-3-Carboxylate 64276-62-6 C13H13NO2 215.25 ETHYL 4-PHENYLPYRROLE-3-CARBOXYLATE; ETHYL 4-PHENYL-1H-PYRROLE-3-CARBOXYLATE; 3-CARBETHOXY-4-PHENYLPYRROLE; SALOR-INT L164313-1EA
ethyl 4-phenylbutanoate 10031-93-3 C12H16O2 192.25 benzenebutanoicacid,ethylester; Ethyl4-phenylbutanoate; 4-Phenyl-butyric acid ethyl ester; ETHYL 4-PHENYLBUTYRATE; ETHYL G-PHENYLBUTYRATE; 4-Phenylbutanoic acid ethyl ester; 4-Phenylbutyric acid ethyl
ETHYL 4-PHENYL-5-(TRIFLUOROMETHYL)THIOPHENE-2-CARBOXYLATE 167279-18-7 C14H11F3O2S 300.3 ETHYL 4-PHENYL-5-(TRIFLUOROMETHYL)THIOPHENE-2-CARBOXYLATE
ETHYL 4-PHENOXYBENZOYLFORMATE 62936-33-8 C16H14O4 270.28 ETHYL 4-PHENOXYBENZOYLFORMATE
ETHYL 3-(3-(AMINOMETHYL)PHENYL)PROPANOATE 93071-66-0 C12H17NO2 207.27 ETHYL 3-(3-(AMINOMETHYL)PHENYL)PROPANOATE
Ethyl 3-(2-Pyridinyl)acrylate, N-Oxide 259729-55-0 C10H11NO3 0 (2E)-3-(1-Oxido-2-pyridinyl)-2-propenoic Acid Ethyl Ester; Ethyl 3-(2-Pyridinyl)acrylate, N-Oxide
ethyl 3-(2-methoxyphenyl)propanoate 70311-27-2 C12H16O3 208.2536
ETHYL 3-(2-FORMYLPHENYL)PROPANOATE 63969-80-2 C12H14O3 206.24 ETHYL 3-(2-FORMYLPHENYL)PROPANOATE
ethyl 3-(2-ethoxy-2-oxo-1-p-tolylethylthio)propanoate 41022-36-0 C16H22O4S 253.226383;g/mol 1-(4-fluorobenzoyl)-4-hydroxy-2-pyrrolidinecarboxylicacid;1-(4-fluorobenzoyl)-4-hydroxypyrrolidine-2-carboxylicacid;497163-88-9;3H-962;1-(4-Fluorobenzoyl)-4-hydroxy-2-pyrrolidine-carboxylicacid;1-[(4-fluorophenyl)carbonyl]-4-hydroxypyrrolidine-2-carboxyli
ethyl 3-(2-ethoxy-2-oxo-1-o-tolylethylthio)propanoate 41022-22-4 C16H22O4S 310.40800
ethyl 3-(2-ethoxy-2-oxo-1-m-tolylethylthio)propanoate 41022-29-1 C16H22O4S 310.40848;g/mol ethyl3-[2-ethoxy-1-(3-methylphenyl)-2-oxoethyl]sulfanylpropanoate;41022-29-1;CTK4I4154;OR066529;OR268430;ethyl3-(2-ethoxy-2-oxo-1-m-tolylethylthio)propanoate
Ethyl 3-(2-ethoxy-1-(4-fluorophenyl)-2-oxoethylthio)propanoate 37136-51-9 C15H19FO4S 314.37200
ETHYL 3-(2-CARBOXY-VINYL)-7-NITRO-1H-INDOLE-2-CARBOXYLATE 885273-57-4 C14H12N2O6 304.25 ETHYL 3-(2-CARBOXY-VINYL)-7-NITRO-1H-INDOLE-2-CARBOXYLATE
Ethyl 2-((2R,3S)-N-(4-methoxyphenyl)-3-methyloxirane-2-carboxamido)acetate 203790-61-8 C15H19NO5 293.31506;g/mol 2-[(2R,3R)-3-ethyl-2-(N-formyl-4-methoxyanilino)-3-methyloxiran-2-yl]aceticacid;
ETHYL 2-((2-METHYL-1H-INDOL-3-YL)METHYLENE)HYDRAZINECARBOXYLATE 113143-56-9 C13H15N3O2 245.2771 ETHYL 2-((2-METHYL-1H-INDOL-3-YL)METHYLENE)HYDRAZINECARBOXYLATE
Ethyl 2-((1S,2R)-2-hydroxy-1,2-diphenylethylamino)acetate 100678-82-8 C18H21NO3 299.36 n-[(1s,2r)-2-hydroxy-1,2-diphenylethyl]-glycine ethyl ester; Ethyl 2-((1S,2R)-2-hydroxy-1,2-diphenylethylamino)acetate
Ethyl 2-((1R,2S)-2-hydroxy-1,2-diphenylethylamino)acetate 112835-62-8 C18H21NO3 299.36 n-[(1r,2s)-2-hydroxy-1,2-diphenylethyl]-glycine ethyl ester; Ethyl 2-((1R,2S)-2-hydroxy-1,2-diphenylethylamino)acetate
ETHYL 2-(([(2,6-DICHLORO-4-PYRIDYL)AMINO]CARBONYL)THIO)ACETATE 286436-03-1 C10H10Cl2N2O3S 309.17 ETHYL 2-(([(2,6-DICHLORO-4-PYRIDYL)AMINO]CARBONYL)THIO)ACETATE
Ethyl 1-trityl-1H-imidazole-4-carboxylate 53525-60-3 C25H22N2O2 0 Ethyl1-trityl-1H-imidazole-4-carboxylate;53525-60-3;KXDKACKOPKUCBU-UHFFFAOYSA-N;ethyl1-tritylimidazole-4-carboxylate;AC1LDGQP;ACMC-209l8h
ETHYL 1-PROPENYL ETHER 928-55-2 C5H10O 86.13 PROPENYL ETHYL ETHER; (1E)-1-Ethoxy-1-propene; 1-Propene, 1-ethoxy-; Ether, ethyl propenyl; ether,ethylpropenyl; ethylpropenylether,mixtureofcis-andtrans-isomers; 1-ETHOXY-1-PROPENE; 1-ethoxypropene
Eriolangin 52617-35-3 C20H28O6 364.43272;g/mol ERIOLANGIN;CHEBI:4835;NSC182855;AC1NQYGY;52617-35-3;NSC-182855
Erioglaucine disodium salt 3844-45-9 C37H34N2Na2O9S3 792.85 1206blue; abcolbluenb; acidblue9,disodium; acidblue9,disodiumsalt; aizenfoodblueno.2; blue1206; brilliantbluefcdno.1; brilliantbluefcfsupra
ERIODICTYOL DIHYDROCHALCONE 57765-66-9 C15H14O6 290.27 ERIODICTYOL DIHYDROCHALCONE; 2',4',6',3,4-PENTAHYDROXYDIHYDROCHALCONE; 2',4',6',3,4-PENTAHYDROXYLDIHYDROCHALCONE; ERIODICTYOL DIHYDROCHALCONE(RG)(CALL)
Dioctadecyl-hexadecyl methyl amine 61788-63-4 0 Dioctadecyl-hexadecyl methyl amine; bis-(Hydrogenatedtallow-alkyl) methylamines; di-(Hydrogenated tallow)methyl amine
dioctadecyl phthalate 14117-96-5 C44H78O4 671.096
Dioctadecyl methyl amine 4088-22-6 C37H77N 536.01 HYDROGEN IONOPHORE III; PROTON IONOPHORE III; N,N-DI-N-OCTADECYLMETHYLAMINE; N,N-DIOCTADECYLMETHYLAMINE; N-METHYL-N-OCTADECYL-1-OCTADECANAMINE; N-METHYLDI-N-OCTADECYLAMINE
dioctadecyl adipate 1119-74-0 C42H82O4 651.09808 dioctadecyl adipate; Distearyl adipate; ADIPICACID,DI-N-OCTADECYLESTER; DI-N-OCTADECYLADIPATE; Hexanedioic acid dioctadecyl ester
Dimethyl (methoxymethyl)succinate 25306-99-4 C8H14O5 190.194 g/mol
Dimethyl (dimethoxyphosphinyl)succinate 2788-26-3 C8H15O7P 254.174 g/mol
Dimethyl (4-hydroxy-2-butenyl) malonate 79193-64-9 C9H14O5 202.20446 Dimethyl (4-hydroxy-2-butenyl) malonate
EC 1.6.4.2 9001-48-3 0 NAD[P]H: OXIDIZED-GLUTATHIONE OXIDOREDUCTASE; NAD[P]H: OXIDIZED-GLUTATHIONE OXIDOREDUCTASE TYPE II; NAD[P]H: OXIDIZED-GLUTATHIONE OXIDOREDUCTASE TYPE VI; GR TYPE II; GR TYPE VI; GR; GLUTATHIONE REDUCTASE; GLUTATHIONE REDUCTASE TYPE II
EC 1.14.14.3 9014-00-0 0 LUCIFERASE, BACTERIAL; LUCIFERASE; BACTERIAL LUCIFERASE; EC 1.14.14.3; LUCIFERASE FROM PHOTOBACT. FISCHERI, LYO PHIL., POWDER; LUCIFERASE BACTERIAL FROM VIBRIO*FISCHER I; LUCIFERASE FIREFLY RECOMBINANT 95+%; LUCIFERASE FROM PH. FISCHERI PARTIALLY PURIFIED
EC 1.1.3.21 9046-28-0 0 L-GLYCEROL 3-PHOSPHATE OXIDASE; L-ALPHA-GLYCEROL-3-PHOSPHATE OXIDASE; GLYCEROL-3-PHOSPHATE OXIDASE; GPO; EC 1.1.3.21; SN-GLYCEROL 3-PHOSPHATE: OXYGEN 2-OXIDOREDUCTASE; glycerol 3-phosphate oxidase F. aerococ. viridans 40 U/mg; Glycerol 3-phosphate Oxidase
ETHYL 4-PENTYNOATE 63093-41-4 126.15
ethyl 4-oxo-4-phenylbutyrate 6270-17-3 C12H14O3 206.24358
ETHYL 4-OXO-4-[3-(3-PYRROLINOMETHYL)PHENYL]BUTYRATE 898749-76-3 C17H21NO3 287.35 ETHYL 4-OXO-4-[3-(3-PYRROLINOMETHYL)PHENYL]BUTYRATE
ethyl 4-oxo-4,5-dihydroisoxazolo[5,4-d]pyrimidine-3-carboxylate 931738-63-5
ethyl 4-oxo-4,5,6,7-tetrahydro-1H-indazole-3-carboxylate 96546-39-3 C10H12N2O3 208.21400
ETHYL 4-OXO-4-(3,4,5-TRIFLUOROPHENYL)BUTYRATE 898752-49-3 C12H11F3O3 260.21 ETHYL 4-OXO-4-(3,4,5-TRIFLUOROPHENYL)BUTYRATE
ethyl 4-oxo-1-phenyl-4,5,6,7-tetrahydro-1H-indazole-3-carboxylate 96546-40-6 C16H16N2O3 284.31000
ethyl 4-oxo-1-phenethylpiperidine-3-carboxylate hydrochloride 1033-93-8 C16H22ClNO3 311.80378 ethyl 4-oxo-1-phenethylpiperidine-3-carboxylate hydrochloride; 3-Carbethoxy-1-(beta-phenethyl)-4-piperidoneHCl]; 3-Carbethoxy-1-(beta-phenethyl)-4-piperidonehydrochloride(); 3-Carbethoxy-1-(B-phenethyl)-4-piperidone hydrochloride
ETHYL 4-N-PROPYLBENZOYLFORMATE 845790-55-8 C13H16O3 220.26 ETHYL 4-N-PROPYLBENZOYLFORMATE
ethyl 4-nitro-1H-pyrrole-2-carboxylate 5930-92-7 C7H8N2O4 184.14 Ethyl 4-nitropyrrole-2-carboxylate; 4-Nitro-1H-pyrrole-2-carboxylic acid ethyl ester; 4-Nitropyrrole-2-carboxylic acid ethyl ester
ethyl 4-nitro-1H-pyrazole-5-carboxylate 55864-87-4 C6H7N3O4 185.14
Ethyl 4-Methylpyrrole-3-Carboxylate 2199-49-7 C8H11NO2 153.18 ETHYL 4-METHYLPYRROLE-3-CARBOXYLATE; 3-CARBETHOXY-4-METHYLPYRROLE; 4-methyl-1H-pyrrole-3-carboxylic acid ethyl ester; ethyl 4-methyl-1H-pyrrole-3-carboxylate
Ethyl 4-Methylpiperidine-4-carboxylate Hydrochloride 225240-71-1 C9H17NO2.HCl 207.70 ethyl4-methylpiperidine-4-carboxylate; hydrochloride; Ethyl4-Methylpiperidine-4-carboxylatehydrochloride; 225240-71-1; Ethyl4-Methylpiperidine-4-carboxylatehydrochloride; PubChem16882
Ethyl 4-Methylpiperidine-4-Carboxylate 103039-88-9 C9H17NO2 171.24
ETHYL 4-METHYLPIPERAZINE-2-CARBOXYLATE 63285-60-9 C8H16N2O2 172.22484 ETHYL 4-METHYLPIPERAZINE-2-CARBOXYLATE
Ethyl 4-methyloxazole-5-carboxylate 20485-39-6 C7H9NO3 155.15 4-METHYL-OXAZOLE-5-CARBOXYLIC ACID ETHYL ESTER; ETHYL 4-METHYL-1,3-OXAZOLE-5-CARBOXYLATE; ethyl 4-methyloxazole-5-carboxylate; EINECS 243-848-9
ETHYL 4-METHYLOCTANOATE 56196-53-3 C11H22O2 186.29 ETHYL 4-METHYLOCTANOATE; EINECS 260-051-1; 4-Methyloctanoic acid ethyl ester; Oryctalure
ETHYL 4-METHYLHEXANOATE 1561-10-0 C9H18O2 158.24 ETHYL 4-METHYLHEXANOATE; 4-Methylhexanoic acid ethyl ester
ETHYL 4-METHYL-5-OXO-4,5-DIHYDRO[1,2,3]TRIAZOLO[1,5-A]QUINAZOLINE-3-CARBOXYLATE 176692-55-0 C13H12N4O3 272.26 BUTTPARK 134\40-23; ETHYL 4-METHYL-5-OXO-4,5-DIHYDRO[1,2,3]TRIAZOLO[1,5-A]QUINAZOLINE-3-CARBOXYLATE
ETHYL 4-METHYL-3,4-DIHYDRO-2H-BENZO[B][1,4]OXAZINE-2-CARBOXYLATE 54442-28-3 C12H15NO3 221.25 ETHYL 4-METHYL-3,4-DIHYDRO-2H-BENZO[B][1,4]OXAZINE-2-CARBOXYLATE; ethyl 4-methyl-3,4-dihydro-2H-1,4-benzoxazine-2-carboxylate
ETHYL 4-METHYL-2-PYRIDIN-3-YL-1,3-THIAZOLE-5-CARBOXYLATE 39091-00-4 C12H12N2O2S 248.30088
Ethyl 4-methyl-2-phenyl-1,3-thiazole-5-carboxylate 53715-64-3 C13H13NO2S 247.31 BUTTPARK 94\16-01; ETHYL 4-METHYL-2-PHENYL-1,3-THIAZOLE-5-CARBOXYLATE; 4-Methyl-2-phenyl-5-thiazolecarboxylicacid,ethylester; ETHYL 4-METHYL-2-PHENYLTHIAZOLE-5-CARBOXYLATE; Ethyl 4-methyl-2-phenyl-1,3-thiazole-5-carboxylate ,97%; Ethyl 4-methyl-2-phenyl-5
ETHYL 4-METHYL-2-PHENYL-1,3-OXAZOLE-5-CARBOXYLATE 4620-52-4 C13H13NO3 231.24722;g/mol ethyl4-methyl-2-phenyl-1,3-oxazole-5-carboxylate;4620-52-4;SCHEMBL11622665;CTK4I9231;MolPort-009-013-652;WDUXWFHGMSDULL-UHFFFAOYSA-N
ETHYL 4-METHOXYCARBONYLBENZOYLACETATE 155877-84-2 C13H14O5 250.25 ETHYL 4-METHOXYCARBONYLBENZOYLACETATE; 4-(METHOXYCARBONYL)-BETA-OXO-BENZENEPROPANOIC ACID ETHYL ESTER
ETHYL 4-METHOXYBENZOYLFORMATE 40140-16-7 C11H12O4 208.21 ETHYL 4-METHOXYBENZOYLFORMATE; ETHYL 2-(4-METHOXYPHENYL)-2-OXOACETATE; (4-METHOXYPHENYL)GLYOXYLIC ACID ETHYL ESTER; ETHYL (4-METHOXYPHENYL)(OXO)ACETATE
ETHYL 4-METHOXYBENZIMIDATE HYDROCHLORIDE 54998-29-7 C10H14ClNO2 215.68 ETHYL 4-METHOXYBENZIMIDATE HYDROCHLORIDE
ETHYL 4-METHOXY-3-OXO-BUTANOATE 66762-68-3 C7H12O4 160.17 ETHYL 4-METHOXY-3-OXO-BUTANOATE; ETHYL 4-METHOXYACETOACETATE; 4-methoxy-acetoacetic acid ethyl ester
ETHYL 4'-METHOXY-3-BIPHENYLCARBOXYLATE 607693-71-0 C16H16O3 256.3 ETHYL 4'-METHOXY-3-BIPHENYLCARBOXYLATE
ETHYL 4-METHOXY-3,5-DIMETHYLBENZOYLFORMATE 107642-57-9 C13H16O4 236.26 ETHYL 4-METHOXY-3,5-DIMETHYLBENZOYLFORMATE; ETHYL 3,5-DIMETHYL-4-METHOXYBENZOYLFORMATE
ethyl 4-methoxy-1-naphthoate 51934-42-0 C30H29F3N8O 0 ethyl 4-methoxy-1-naphthoate
ETHYL 4-METHOXY-1H-INDAZOLE-3-CARBOXYLATE 885279-49-2 C11H12N2O3 220.22 ETHYL 4-METHOXY-1H-INDAZOLE-3-CARBOXYLATE
ETHYL 4-MERCAPTOCINNAMATE 1076198-07-6 C11H12O2S 208.27678 ETHYL 4-MERCAPTOCINNAMATE
Ethyl 4-isopropylpiperazine-1-carboxylate 61014-91-3 MFCD08064222 200.28
ETHYL 4-ISO-PROPYLBENZOYLFORMATE 34906-84-8 C13H16O3 220.26 ETHYL 4-ISO-PROPYLBENZOYLFORMATE
Ethyl 4-isopropyl-6-methyl-2-oxo-1,2,3,4-tetrahydro-5-pyrimidinecarboxylate 198826-86-7 226.28
ETHYL 4-ISOPROPYL-2-PYRROLIDINECARBOXYLATE 99176-42-8 C10H19NO2 185.26 ETHYL 4-ISOPROPYL-2-PYRROLIDINECARBOXYLATE
Ethyl 4-hydroxynicotinate 57905-31-4 C8H9NO3 167.16 Ethyl 4-hydroxynicotinate; 4-Hydroxynicotinic acid ethyl ester; 4-Hydroxy-3-pyridinecarboxylic acid ethyl ester
ETHYL 4-HYDROXYBENZOFURAN-2-CARBOXYLATE 127724-14-5 C11H10O4 206.19 ETHYL 4-HYDROXYBENZOFURAN-2-CARBOXYLATE
Ethyl 4-Hydroxybenzoate-2,3,5,6-d4 1219795-53-5
ETHYL 4-HYDROXY-7-NITROQUINOLINE-3-CARBOXYLATE 7248-88-6 C12H10N2O5 262.22 ETHYL 4-HYDROXY-7-NITROQUINOLINE-3-CARBOXYLATE
ethyl 4-hydroxy-7H-pyrrolo[2,3-d]pyrimidine-6-carboxylate 187724-99-8 C9H9N3O3 207.19 ethyl 4-hydroxy-7H-pyrrolo[2,3-d]pyrimidine-6-carboxylate
ETHYL 4-HYDROXY-5-OXO-1-(2-THIENYLMETHYL)-2,5-DIHYDRO-1H-PYRROLE-3-CARBOXYLATE 131436-78-7 C12H13NO4S 267.3 ETHYL 4-HYDROXY-5-OXO-1-(2-THIENYLMETHYL)-2,5-DIHYDRO-1H-PYRROLE-3-CARBOXYLATE
Ethyl 4-hydroxy-5-isopropylpyrrolo[1,2-f][1,2,4]triazine-6-carboxylate 651744-40-0 C12H15N3O3 249.268
ethyl 4-hydroxy-4-phenylpiperidine-1-carboxylate 16332-22-2 C14H19NO3 249.30556 ethyl 4-hydroxy-4-phenylpiperidine-1-carboxylate; 4-Hydroxy-4-phenyl-1-piperidinecarboxylic acid ethyl ester; Einecs 240-406-7
Ethyl 4-hydroxy-4(2-hydroxymethylphenyl)-1-piperidine carboxylate 71546-51-5 C15H21NO4 279.34
ETHYL 4-HYDROXY-3-NITROBENZOATE 19013-10-6 C9H9NO5 211.17 ETHYL-3-NITRO-4-HYDROXYBENZOATE; ETHYL 4-HYDROXY-3-NITROBENZOATE; LABOTEST-BB LT00848185; 3-NITRO-4-HYDROXYBENZOIC ACID ETHYL ESTER; 4-HYDROXY-3-NITROBENZOIC ACID ETHYL ESTER; RARECHEM AL BI 0172
Ethyl 4-Hydroxy-2-Nitrobenzoate 104356-27-6 C9H9NO5 211.17 Ethyl 4-hydroxy-2-nitrobenzoate; 4-Hydroxy-2-nitrobenzoic acid ethyl ester
Ethyl 4-hydroxy-2H-1,2-benzothiazine-3-carboxylate 1,1-dioxide 24683-21-4 C11H11NO5S 269.27 Ethyl 4-hydroxy-2H-1,2-benzothiazine-3-carboxylate 1,1-dioxide; Ethyl 4-Hydroxy-2H-1,2-benzothiazine-3-carboxylate 1,1-Dioxide(Piroxicam Impurity H); 4-Hydroxy-2H-1,2-benzothiazine-3-carboxylid acid ethyl ester 1,1-dioxide
ETHYL 4-HYDROXY-2-[4-(TRIFLUOROMETHYL)PHENYL]-1,3-THIAZOLE-5-CARBOXYLATE 227199-08-8 C13H10F3NO3S 317.28 ETHYL 4-HYDROXY-2-[4-(TRIFLUOROMETHYL)PHENYL]-1,3-THIAZOLE-5-CARBOXYLATE; ETHYL 4-HYDROXY-2-[4-(TRIFLUOROMETHYL)PHENYL]THIAZOLE-5-CARBOXYLATE
ETHYL 4-HYDROXY-2-[3-(TRIFLUOROMETHYL)PHENYL]-1,3-THIAZOLE-5-CARBOXYLATE 240800-53-7 C13H10F3NO3S 317.28 ETHYL 4-HYDROXY-2-[3-(TRIFLUOROMETHYL)PHENYL]-1,3-THIAZOLE-5-CARBOXYLATE; ETHYL 4-HYDROXY-2-[3-(TRIFLUOROMETHYL)PHENYL]THIAZOLE-5-CARBOXYLATE
ETHYL 4-HYDROXY-2-(4-METHYLPHENYL)-1,3-THIAZOLE-5-CARBOXYLATE 263016-18-8 C13H13NO3S 263.31 ETHYL 4-HYDROXY-2-(4-METHYLPHENYL)-1,3-THIAZOLE-5-CARBOXYLATE; ETHYL 4-HYDROXY-2-(4-METHYLPHENYL)THIAZOLE-5-CARBOXYLATE
Ethyl 4-hydroxy-2-(2-pyridinyl)-5-pyrimidinecarboxylate 60060-10-8 C12H11N3O3 245.24
ETHYL 4-HYDROXY-1-(4-METHOXYPHENYL)-1H-PYRAZOLE-3-CARBOXYLATE 39683-26-6 C13H14N2O4 262.26 ETHYL 4-HYDROXY-1-(4-METHOXYPHENYL)-1H-PYRAZOLE-3-CARBOXYLATE; IFLAB-BB F1174-1794; 4-HYDROXY-1-(4-METHOXY-PHENYL)-1H-PYRAZOLE-3-CARBOXYLIC ACID ETHYL ESTER
ethyl 4-formyl-1,2,3-thiadiazole-5-carboxylate 4609-58-9 C6H6N2O3S 186.18844;g/mol ethyl4-formylthiadiazole-5-carboxylate;ethyl4-formyl-1,2,3-thiadiazole-5-carboxylate;4609-58-9;CTK8D4049;ZINC39204219;HE039933
Ethyl 4-Fluoropiperidine-4-carboxylate Hydrochloride 845909-49-1 C8H14FNO2.HCl 211.66200
Ethyl 4-fluorobenzoylformate 1813-94-6
ETHYL 4-FLUOROBENZIMIDATE HYDROCHLORIDE 4278-01-7 C9H11ClFNO 203.64 ETHYL 4-FLUOROBENZIMIDATE HYDROCHLORIDE
Ethyl 4-fluoro-3-oxopentanoate 227184-02-3 C7H11FO3 162.16 ETHYL 4-FLUORO-3-OXOPENTANOATE; Ethyl 4-Fluoro-oxopentanoate
ethyl 4-fluoro-3-isopropylbenzoate 1112179-21-1
Ethyl 4-fluoro-3-(trifluoromethyl)benzoate 67515-63-3
ETHYL 4-ETHYLBENZOYLFORMATE 62936-36-1 C12H14O3 206.24 ETHYL 4-ETHYLBENZOYLFORMATE
ethyl 4-ethyl-4-octadecylmorpholinium sulphate 10096-64-7 C26H55NO5S 493.7836 ethyl 4-ethyl-4-octadecylmorpholinium sulphate; N-Cetyl-N-ethyl morpholinium ethyl sulfate
Ethyl 4-ethoxybenzoylformate 70080-61-4 C12H14O4 222.24 ETHYL 4-ETHOXYBENZOYLFORMATE
Ethyl 4-ethoxy-2-pyridinecarboxylate 71777-70-3 C10H13NO3 195.22 4-Ethoxy-2-pyridinecarboxylic acid ethyl ester; Ethyl 4-ethoxy-2-pyridinecarboxylate; Ethyl 4-ethoxypicolinate; 4-Ethoxypyridine-2-carboxylic acid ethyl ester
ethyl 4-dimethylamino-8-methyl-7-oxo-pteridine-6-carboxylate 2046-68-6 C12H15N5O3 277.2792
ethyl 4-cyclopropylbenzoate 35391-85-6 C12H14O2 190.23836;g/mol ethyl4-cyclopropylbenzoate; 4-cyclopropylbenzoicacidethylester; 35391-85-6; SCHEMBL4003420; DWMHLKSASWMUFX-UHFFFAOYSA-N; 4cyclopropyl-benzoicacidethylester
ETHYL 4-CYANOPIPERIDINE-1-CARBOXYLATE 182808-28-2 C9H14N2O2 182.22 ETHYL 4-CYANOPIPERIDINE-1-CARBOXYLATE; 4-CYANO-1-PIPERIDINECARBOXYLIC ACID ETHYL ESTER; 1-Piperidinecarboxylicacid,4-cyano-,ethylester(9CI); TERT-BUTYL 4-CYANOPIPERAZINE-1-CARBOXYLATE
Ethyl 4-cyanocinnamate 62174-99-6 C12H11NO2 201.22 4-Cyanocinnamic Acid Ethyl Ester
Ethyl 4-chloro-6-methyl-2-quinazolinecarboxylate 620957-95-1 C12H11ClN2O2 250.68
Ethyl 4-chloro-6,7-dimethoxyquinazoline-2-carboxylate 1189105-82-5
ETHYL 4-CHLORO-5-METHYL-7-PHENYL-7H-PYRROLO[2,3-D]PYRIMIDINE-6-CARBOXYLATE 245728-43-2 C16H14ClN3O2 315.75 ETHYL 4-CHLORO-3-METHYL-1-PHENYL-1H-PYRROLO[2,3-D]PYRIMIDINE-2-CARBOXYLATE; ETHYL 4-CHLORO-5-METHYL-7-PHENYL-7H-PYRROLO[2,3-D]PYRIMIDINE-6-CARBOXYLATE
Ethyl 4-chloro-5-isopropylpyrrolo[2,1-f][1,2,4]triazine-6-carboxylate 658084-80-1 C12H14ClN3O2 267.715
Ethyl 4-bromo-3-methylbenzoate 160313-69-9 C10H11BrO2 243.1 ETHYL 4-BROMO-3-METHYLBENZOATE; Benzoic acid, 4-bromo-3-methyl-, ethyl ester
Ethyl 4-bromo-3-methoxybut-2-enoate 1116-51-4
Ethyl 4-bromo-3-hydroxybenzoate 33141-66-1 C9H9BrO3 245.06996 ETHYL 4-BROMO-3-HYDROXYBENZOATE
ethyl 4-bromo-1H-pyrrolo[2,3-b]pyridine-2-carboxylate 942920-55-0 C10H9BrN2O2 269.09 ethyl 4-bromo-1H-pyrrolo[2,3-b]pyridine-2-carboxylate
Ethyl 4-bromo-1,3-dimethylpyrazole-5-carboxylate 50920-64-4 C8H11BrN2O2 0 ethyl1-ethyl-3-methyl-1H-pyrazole-5-carboxylate;50920-64-4;1-ethyl-3-methyl-1h-pyrazole-5-carboxylicacidethylester;5775-89-3;ethyl2-ethyl-5-methylpyrazole-3-carboxylate;ethyl1-ethyl-3-methylpyrazole-5-carboxylate
Ethyl 4,6-dichloro-3-formyl-1H-indole-2-carboxylate 153435-96-2 C12H9Cl2NO3 285.10 ETHYL 4,6-DICHLORO-3-FORMYL-1H-INDOLE-2-CARBOXYLATE; 4,6-DICHLORO-3-FORMYL-1H-INDOLE-2-CARBOXYLIC ACID ETHYL ESTER
Ethyl 4,6-dichloro-2-(methylthio)quinoline-3-carboxylate 227958-96-5 C13H11Cl2NO2S 316.2 BUTTPARK 93\04-07; ETHYL 4,6-DICHLORO-2-(METHYLTHIO)QUINOLINE-3-CARBOXYLATE
Ethyl 4,6-dibromo-5-hydroxy-2-methyl-1-benzofuran-3-carboxylate 7287-42-5 C12H10Br2O4 378.03
ETHYL 4,6-BIS(4-CHLOROPHENYL)-2-OXO-3-CYCLOHEXENE-1-CARBOXYLATE 26379-96-4 C21H18Cl2O3 389.27 ETHYL 4,6-BIS(4-CHLOROPHENYL)-2-OXO-3-CYCLOHEXENE-1-CARBOXYLATE
Ethyl 4,5-diphenyl-1H-pyrrole-3-carboxylate 73799-68-5 C19H17NO2 0 1H-Pyrrole-3-carboxylicacid,4,5-diphenyl-,ethylester(9CI)
Ethyl 4,4,4-trifluoro-3-(trifluoromethyl)crotonate 1513-60-6 C7H6F6O2 236.11 ETHYL 3,3-BIS(TRIFLUOROMETHYL)ACRYLATE; ETHYL 4,4,4-TRIFLUORO-3-(TRIFLUOROMETHYL)CROTONATE; ETHYL 4,4,4-TRIFLUORO-3-(TRIFLUOROMETHYL)-2-BUTENOATE; ET-BTFA; 4,4,4-Trifluoro-3-(trifluoromethyl)crotonic acid ethyl ester; Ethyl 4,4,4-trifluoro-3-(trifluoromet
ETHYL 4,4,4-TRIFLUORO-3-(TRIFLUOROMETHYL)BUTYRATE 17327-34-3 C7H8F6O2 238.13 ETHYL 4,4,4-TRIFLUORO-3-(TRIFLUOROMETHYL)BUTYRATE
ETHYL 4-(TRIMETHYLSILYLOXY)-2-BUTYNOATE 122850-62-8 C9H16O3Si 200.31 TIMTEC-BB SBB008831; ETHYL 4-TRIMETHYLSILOXY-2-BUTYNOATE; ETHYL 4-(TRIMETHYLSILYLOXY)-2-BUTYNOATE
ETHYL 4-(TRIFLUOROMETHYL)BENZOATE 31083-14-4 C10H9F3O2 218.18 ethyl4-(trifluoromethyl)benzoate; Ethyl4-(trifluoromethyl)benzoate; 583-02-8; 4-(trifluoromethyl)benzoicacidethylester; 31083-14-4; ethyl4-trifluoromethylbenzoate
ETHYL 4(S)-BOC-AMINO-7-CBZ-AMINO-3-OXO-HEPTANOATE 150618-12-5 C22H32N2O7 436.5 ETHYL 4(S)-BOC-AMINO-7-CBZ-AMINO-3-OXO-HEPTANOATE
Ethyl 4-(phenylthio)acetoacetate 25907-38-4 C12H14O3S 238.30 ethyl3-oxo-4-phenylsulfanylbutanoate; ethyl4-(phenylthio)acetoacetate; 25907-38-4; Ethyl3-oxo-4-phenylsulfanyl-butanoate; SCHEMBL6421307; ZINC4759547
Ethyl 4-(phenylethynyl)benzoate 63164-96-5 C17H14O2 250.29 RARECHEM AL BI 0963; 4-(2-PHENYLETHYNYL)BENZOIC ACID ETHYL ESTER; Ethyl 4-(phenylethynyl)benzoate
Ethyl 4-(N,N-diethylamino)benzoate 10287-54-4 C13H19NO2 221.3 Ethyl 4-(N,N-diethylamino)benzoate; Ethyl p-diethylaminobenzoate
ethyl 4-(methylthio)butyrate 22014-48-8 C7H14O2S 162.24986 ethyl 4-(methylthio)butyrate; Butanoic acid, 4-(methylthio)-, ethyl ester; 4-(Methylthio)butanoic acid ethyl ester; 4-(Methylthio)butyric acid ethyl ester
ethyl 4-(dipropylamino)-4-oxobutanoate 10143-31-4 C12H23NO3 229.316 g/mol
ETHYL 4-(AMINOMETHYL)CYCLOHEXANECARBOXYLATE 35879-53-9
ETHYL 4-(AMINOMETHYL)-1-CYCLOPROPYL-2,5-DIMETHYL-1H-PYRROLE-3-CARBOXYLATE HYDROCHLORIDE 465515-33-7 C13H21ClN2O2 272.77 ETHYL 4-(AMINOMETHYL)-1-CYCLOPROPYL-2,5-DIMETHYL-1H-PYRROLE-3-CARBOXYLATE HYDROCHLORIDE; Ethyl 4-(aminomethyl)-1-cyclopropyl-2,5-dimethyl-1H-pyrrole-3-carboxylate hydrochlor; Ethyl4-(aminomethyl)-1-cyclopropyl-2,5-dimethyl-1H-pyrrole-3-carboxylateHCl
Ethyl 4-(acetoacetylamino)benzoate 30764-23-9 C13H15NO4 249.27
ETHYL 4-(4-T-BUTYLPHENYL)-4-OXOBUTYRATE 75237-09-1 C16H22O3 262.34 ETHYL 4-(4-T-BUTYLPHENYL)-4-OXOBUTYRATE; ETHYL 4-(4-TERT-BUTYLPHENYL)-4-OXOBUTYRATE
ETHYL 4-(4-METHYLPIPERAZIN-1-YL)BENZOATE 773137-71-6 C14H20N2O2 0 ETHYL 4-(4-METHYLPIPERAZIN-1-YL)BENZOATE
ethyl 4-(4-methylphenyl )-4-oxobutyrate 6942-61-6 C13H16O3 220.27067
ETHYL 4-(4-METHOXYPHENYL)-2-METHYLTHIAZOLE-5-CARBOXYLATE 887590-01-4 C14H15NO3S 277.34 ETHYL 4-(4-METHOXYPHENYL)-2-METHYLTHIAZOLE-5-CARBOXYLATE
Ethyl 4-(4-Methoxy-3-methylphenyl)-4-oxobutanoate 2954-68-9 C14H18O4 250.29716
ethyl 4-(4-hydroxyphenyl)-1-methylpiperidin-1-ium-4-carboxylate chloride 4220-06-8 C15H22ClNO3 299.793 g/mol
Ethyl 4-(4-fluorophenyl)-6-isopropyl-2-(N-methylmethylsulfonamido)pyrimidine-5-carboxylate-d6 1189696-04-5 C18H16D6FN3O4S 401.485353868 ETHYL 4-(4-FLUOROPHENYL)-6-ISOPROPYL-2-(N-METHYLMETHYLSULFONAMIDO)PYRIMIDINE-5-CARBOXYLATE-D6
Ethyl 4-(4-fluorophenyl)-6-isopropyl-2-(methylsulfonyl)pyrimidine-5-carboxylate-d6 1185128-49-7 C17H13D6FN2O4S 372.444133868 ETHYL 4-(4-FLUOROPHENYL)-6-ISOPROPYL-2-(METHYLSULFONYL)PYRIMIDINE-5-CARBOXYLATE-D6; (2-(Propyl-3,3,3-d3)pentanoic-5,5,5-D Acid)
ETHYL 4-(4-FLUOROPHENYL)-4-OXOBUTYRATE 41310-80-9 C12H13FO3 224.23 4-(4-FLUORO-PHENYL)-4-OXO-BUTYRIC ACID ETHYL ESTER; ETHYL 4-(4-FLUOROPHENYL)-4-OXOBUTYRATE
ethyl 4-(4-fluoro-2-methyl-1H-indol-5-yloxy)-5-methylpyrrolo[1,2-f][1,2,4]triazine-6-carboxylate 649736-29-8
ethyl 4-(4-chloro-3-(trifluoromethyl)phenyl)-4-hydroxypiperidine-1-carboxylate 21928-40-5 C15H17ClF3NO3 351.75 ethyl 4-[4-chloro-3-(trifluoromethyl)phenyl]-4-hydroxypiperidine-1-carboxylate; 4-[4-Chloro-3-(trifluoromethyl)phenyl]-4-hydroxy-1-piperidinecarboxylic acid ethyl ester; Einecs 244-664-1
Ethyl 4-(4-bromophenyl)piperazine-1-carboxylate 1226808-66-7 C13H17BrN2O2 0 4-(4-Ethoxycarbonyl)piperazino-1-bromobenzene; Ethyl 4-(4-bromophenyl)piperazine-1-carboxylate
Ethyl 4-(4-aminophenyl)tetrahydro-1(2H)-pyrazinecarboxylate 16154-70-4 C13H19N3O2 249.32
Ethyl 4-(4-aminobutyl)piperazine-1-carboxylate 83089-23-0 C11H23N3O2 229.31900
Ethyl 4-(4,5-dibromothiophen-2-yl)benzoate 222840-93-9 C13H10Br2O2S 390.09 ETHYL 4-(4,5-DIBROMOTHIOPHEN-2-YL)BENZOATE
ETHYL 4-(3-NITROPYRIDIN-4-YLAMINO)BENZOATE 145079-07-8 C14H13N3O4 287.27 ETHYL 4-(3-NITROPYRIDIN-4-YLAMINO)BENZOATE
Ethyl 4-(3-hydroxyphenyl)butyrate 160721-25-5 C12H16O3 208.25 Ethyl 4-(3-hydroxyphenyl)butanoate; 3-Hydroxy-benzenebutanoic acid ethyl ester
ethyl 4-(2-piperidin-1-ium-1-ylpropanoylamino)benzoate chloride 106572-14-9 C17H25ClN2O3 340.845 g/mol
Ethyl 4-(2-nitrophenyl)acetoacetate 66073-33-4
ETHYL 4-(2-METHYL-4-OXOQUINAZOLIN-3(4H)-YL)BENZOATE 4005-02-1 C18H16N2O3 308.33 ETHYL 4-(2-METHYL-4-OXOQUINAZOLIN-3(4H)-YL)BENZOATE
ethyl 4-(2-hydroxyphenyl)butanoate 20921-17-9 C12H16O3 208.25 Ethyl 4-(2-hydroxyphenyl)butanoate; 2-Hydroxy-benzenebutanoic acid ethyl ester
ETHYL 4-(2-FURYL)-3-OXOBUTANOATE 577776-75-1 C10H12O4 196.19988;g/mol ethyl4-(furan-2-yl)-3-oxobutanoate;Ethyl4-(2-furyl)-3-oxobutanoate;577776-75-1;CTK5A7423;ZINC22114818;AKOS006291366
ETHYL 4-(2-ETHOXY-2-OXOETHYLIDENE)CYCLOHEXANE-1-CARBOXYLATE 81144-09-4 C13H20O4 240.3 ETHYL 4-(2-ETHOXY-2-OXOETHYLIDENE)CYCLOHEXANE-1-CARBOXYLATE
Ethyl 4-(2-chloroethoxy)benzoate 40992-21-0 C11H13ClO3 228.67 ETHYL 4-(2-CHLOROETHOXY)BENZOATE; 4-(2-Chloroethoxy)benzoic acid ethyl ester
ETHYL 4-(2-CHLORO-3-PYRIDYL)-4-OXOBUTYRATE 852063-32-2 C11H12ClNO3 241.67 ETHYL 4-(2-CHLORO-3-PYRIDYL)-4-OXOBUTYRATE
ETHYL 4-(2,5-DIMETHYLPHENYL)-4-OXOBUTYRATE 30005-21-1 C14H18O3 234.29 ETHYL 4-(2,5-DIMETHYLPHENYL)-4-OXOBUTYRATE
ETHYL 4-(2,5-DIFLUOROPHENYL)-4-OXOBUTYRATE 898753-14-5 C12H12F2O3 242.22 ETHYL 4-(2,5-DIFLUOROPHENYL)-4-OXOBUTYRATE
Ethyl 4-(1,1,2,2-tetrafluoroethoxy)benzoate 37178-69-1 C11H10F4O3 266.19 ethyl4-(1,1,2,2-tetrafluoroethoxy)benzoate; ETHYL4-(1,1,2,2-TETRAFLUOROETHOXY)BENZOATE; 37178-69-1; CTK1B5839; ZINC2389927; OR061762
ETHYL 4-([(4-CHLOROBUTYL)SULFONYL]AMINO)BENZOATE 219793-79-0 C13H18ClNO4S 319.8 ETHYL 4-([(4-CHLOROBUTYL)SULFONYL]AMINO)BENZOATE
ETHYL 4-([(1E)-(2-HYDROXY-1-NAPHTHYL)METHYLENE]AMINO)BENZOATE 743-91-9 C20H17NO3 319.3539
Ethyl 4-((1-((4-fluorophenyl)methyl)-1H-benzimidazol-2-yl)amino)piperidine-1-carboxylate 84501-68-8 C22H25FN4O2 396.46 ethyl 4-[[1-[(4-fluorophenyl)methyl]-1H-benzimidazol-2-yl]amino]piperidine-1-carboxylate; 4-[[1-(4-Fluorobenzyl)-1H-benzimidazol-2-yl]amino]-1-piperidinecarboxylic acid ethyl ester; 4-[1-(4-Fluorobenzyl)-1H-benzimidazole-2-ylamino]piperidine-1-carboxylic
ethyl 4-(((ethylphenylamino)methylene)-amino)benz 65816-20-8 C18H20N2O2 296.36 4-[[(ethylphenylamino)methylene]amino]-benzoicaciethylester; N-(Ethoxycarbonylphenyl)-N'-ethy-N'-phenyl formamidine; 4-[[(ETHYLPHENYLAMINO)METHYLENE]AMINO]-BENZOIC ACID; 4-[(ETHYLPHENYLAMINO)METHYLENEAMINO]BENZOIC ACID ETHYL ESTER; ETHYL 4-[[(ETHYLPHENYLA
ETHYL 3-TERT-BUTYL-1-(2,4,6-TRIMETHYLBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE 306936-99-2 C20H28N2O2 328.45 ETHYL 3-TERT-BUTYL-1-(2,4,6-TRIMETHYLBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE; ETHYL 3-(TERT-BUTYL)-1-(MESITYLMETHYL)-1H-PYRAZOLE-5-CARBOXYLATE
ethyl 3-p-tolyloxirane-2-carboxylate 52788-71-3 C12H14O3 206.23776 ethyl 3-p-tolyloxirane-2-carboxylate; Oxiranecarboxylic acid, 3-(4-methylphenyl)-, ethyl ester; 3-(4-methylphenyl)-oxiranecarboxylic acid ethyl ester; 3-(4-Methylphenyl)-glycidic acid ethyl ester; ALDEHYDE C-20 FOOD GRADE KOSHER; ALDEHYDE C-20 FRAGRANCE G
Ethyl 3-phenylpiperazine-1-carboxylate 904814-49-9 C13H18N2O2 234.29 Ethyl 3-phenylpiperazine-1-carboxylate; 3-Phenyl-piperazine-1-carboxylic acid ethyl ester
ETHYL 3-PHENYL-6,7-DIHYDRO-5H-CYCLOPENTA[C]PYRIDINE-1-CARBOXYLATE 692729-86-5 C17H17NO2 267.32 ETHYL 3-PHENYL-6,7-DIHYDRO-5H-CYCLOPENTA[C]PYRIDINE-1-CARBOXYLATE
ETHYL 3-PHENYL-4-ISOQUINOLINECARBOXYLATE 109802-64-4 C18H15NO2 277.32 ETHYL 3-PHENYL-4-ISOQUINOLINECARBOXYLATE
ethyl 3-phenyl-1,2,4-thiadiazole-5-carboxylate 50483-79-9 C11H10N2O2S 234.27400
Ethyl 3-oxodecanoate 13195-66-9 C12H22O3 214.30 ETHYL 3-OXODECANOATE; 3-Ketocapric acid ethyl ester; 3-Oxodecanoic acid ethyl ester; Decanoic acid, 3-oxo-, ethyl ester; Einecs 236-157-9
Ethyl 3-oxo-3-(3-thienyl)propionate 53090-46-3 C9H10O3S 198.24 ETHYL 3-OXO-3-(THIOPHEN-3-YL)PROPANOATE; ETHYL-3-THIOPHENOYL-ACETATE; Ethyl 3-oxo-3-(3-thienyl)propionate
Ethyl 3-oxo-3-(3-pyridyl)propionate 6283-81-4 C10H11NO3 193.20 TIMTEC-BB SBB010886; ETHYL 3-OXO-3-(3-PYRIDYL)PROPIONATE; ETHYL-3-PYRIDOYL ACETATE; 3-OXO-3-PYRIDIN-3-YL-PROPIONIC ACID ETHYL ESTER
Ethyl 3-oxo-3-(2,3,4-trichlorophenyl)propanoate 63131-34-0 C11H9Cl3O3 295.55 ETHYL 3-OXO-3-(2,3,4-TRICHLOROPHENYL)PROPANOATE
ethyl 3-oxo-2-(2-thienylcarbonyl)butanoate 13892-51-8 C11H12 O4 S 240.28 AKOS MSC-0286; 3-OXO-2-(THIOPHENE-2-CARBONYL)-BUTYRIC ACID ETHYL ESTER; ETHYL 3-OXO-2-(2-THIENYLCARBONYL)BUTANOATE; ETHYL 2-(2-THENOYL)ACETOACEATE
ETHYL 3-HYDROXY-4,4,4-TRICHLOROBUTYRATE 19486-93-2 C6H9Cl3O3 235.49 ETHYL 3-HYDROXY-4,4,4-TRICHLOROBUTYRATE; Butanoic acid, 4,4,4-trichloro-3-hydroxy-, ethyl ester
Ethyl 3-Hydroxy-3-methyl-d3-butyrate-4,4,4-d3 30385-86-5 HO(CD3)2CCH2COOCH2CH3 152.22
ethyl 3-hydroxy-3-methylbutyrate 18267-36-2 C7H14O3 146.18426 ethyl 3-hydroxy-3-methylbutyrate; (CH3)2C(OH)CH2C(O)OC2H5; 3-Hydroxy-3-methylbutanoic acid ethyl ester; Einecs 242-147-5
Ethyl 3-hydroxy-3-methyl-4,4,4-trifluorobutanoate 649-67-2 C7H11F3O3 200.1549 Ethyl 3-hydroxy-3-methyl-4,4,4-trifluorobutyrate
ethyl 3-hydroxy-3-methyl-1-tosylpyrrolidine-2-carboxylate 3284-52-4 C15H21NO5S 327.39 ethyl 3-hydroxy-3-methyl-1-tosylpyrrolidine-2-carboxylate
Ethyl 3-hydroxy-2-naphthoate 7163-25-9 O=C(c1cc2ccccc2cc1O)OCC 216.23 Ethyl 3-hydroxynaphthalene-2-carboxylate
Ethyl 3-hydrazinobenzoate 90556-87-9 C9H12N2O2 180.20 3-HYDRAZINO-BENZOIC ACID ETHYL ESTER; 3-HYDRAZINO-BENZOIC ACID ETHYL ESTER HCL; 3-HYDRAZINO-BENZOIC ACID ETHYL ESTER HYDROCHLORIDE; Ethyl-3-HydrazinoBenzoate
Ethyl 3-hexenoate (trans) 26553-46-8 C8H14O2 142.2 FEMA 3342; ETHYL TRANS-3-HEXENOATE; ETHYL T3 HEXENOATE; ETHYL CIS-3-HEXENOATE; Ethyl (E)-3-hexenoate; ethyl (E)-hex-3-enoate; Ethyl trans-hex-3-enoate; 3-Hexenoic acid, ethyl ester, (3E)-
ETHYL 3-FUROATE 614-98-2 C7H8O3 140.14 RARECHEM AL BI 0196; ETHYL 3-FURANCARBOXYLATE; ETHYL 3-FUROATE; 3-FUROIC ACID ETHYL ESTER; 3-FURANCARBOXYLIC ACID ETHYL ESTER; Ethyl-3-fluroate; Ethyl 3-furoate 98%; Ethyl 3-furoate, GC 99%
Ethyl 3-Formylindole-7-Carboxylate 927181-98-4 C12H11NO3 217.22
Ethyl 3-Formylindole-6-Carboxylate 927181-97-3 C12H11NO3 217.22
Ethyl 3-formyl-7-nitro-1H-indole-2-carboxylate 885273-53-0 C12H10N2O5 262.22 ETHYL 3-FORMYL-7-NITRO-1H-INDOLE-2-CARBOXYLATE
ETHYL 3-FORMYL-6-METHYL-4-PHENYL-2-THIOXO-1,2,3,4-TETRAHYDRO-5-PYRIMIDINECARBOXYLATE 123044-10-0 C15H16N2O3S 304.36 AURORA KA-3498; ETHYL 3-FORMYL-6-METHYL-4-PHENYL-2-THIOXO-1,2,3,4-TETRAHYDRO-5-PYRIMIDINECARBOXYLATE; ETHYL 3-FORMYL-6-METHYL-4-PHENYL-2-THIOXO-1,2,3,4-TETRAHYDROPYRIMIDINE-5-CARBOXYLATE
Ethyl 3-formyl-5-nitro-1H-indole-2-carboxylate 22120-89-4 C12H10N2O5 262.22 ETHYL 3-FORMYL-5-NITRO-1H-INDOLE-2-CARBOXYLATE; 3-FORMYL-5-NITRO-1H-INDOLE-2-CARBOXYLIC ACID ETHYL ESTER
ETHYL 3-EXO-AMINOBICYCLO[2.2.1]HEPTANE-2-EXO-CARBOXYLATE HYDROCHLORIDE 95630-75-4 C10H18ClNO2 219.71 DIEXO-3-AMINO-BICYCLO[2.2.1]HEPTANE-2-CARBOXYLIC ACID ETHYL ESTER HYDROCHLORIDE; ETHYL 3-EXO-AMINOBICYCLO[2.2.1]HEPTANE-2-EXO-CARBOXYLATE HYDROCHLORIDE; ethyl3-exo-aminobicyclo[2.2.1]heptane-2-exo-carboxylateHCl; Ethyl 3-exo-aminobicyclo[2.2.1]heptane-2-e
ETHYL 3-EXO-AMINOBICYCLO[2.2.1]HEPT-5-ENE-2-EXO-CARBOXYLATE HYDROCHLORIDE 104770-18-5 C10H16ClNO2 217.69 ETHYL 3-EXO-AMINOBICYCLO[2.2.1]HEPT-5-ENE-2-EXO-CARBOXYLATE HYDROCHLORIDE; DIEXO-3-AMINO-BICYCLO[2.2.1]HEPT-5-ENE-2-CARBOXYLIC ACID ETHYL ESTER HYDROCHLORIDE; Ethyl3-exo-aminobicyclo[2.2.1]hept-5-ene-2-exo-carboxylateHCl; Ethyl 3-exo-aminobicyclo[2.2.1]he
ETHYL 3-ETHYL-1,2,4-OXADIAZOLE-5-CARBOXYLATE 139443-40-6 C7H10N2O3 170.17 ETHYL 3-ETHYL-1,2,4-OXADIAZOLE-5-CARBOXYLATE; 1,2,4-Oxadiazole-5-carboxylicacid,3-ethyl-,ethylester(9CI)
ETHYL 3-DI-N-PROPYLAMINOPROPIONATE 42980-55-2 C11H23NO2 201.31 ETHYL 3-DI-N-PROPYLAMINOPROPIONATE; ETHYL-BETA-DIPROPYLAMINOPROPIONATE; ethyl N,N-dipropyl-beta-alaninate
Ethyl 3-dimethylaminopropionate 20120-21-2 C7H15NO2 145.20 ethylbeta-(dimethylamino)propionate; n,n-dimethyl-beta-alaninethylester; 3-DIETHYLAMINOPROPIONIC ACID ETHYL ESTER; ETHYL BETA-DIETHYLAMINO PROPIONATE; ETHYL 3-DIMETHYLAMINOPROPIONATE; ETHYL 3-(DIETHYLAMINO)PROPANOATE
Ethyl 3,5-dichloro-4-methoxybenzoate 15945-28-5 C10H10Cl2O3 249.09 ETHYL 3,5-DICHLORO-4-METHOXYBENZOATE; 3,5-DICHLORO-4-METHOXYBENZOIC ACID ETHYL ESTER; Einecs 240-080-6
ETHYL 3,5-DICHLORO-4-HYDROXYBENZOATE HYD RATE, 98% 207291-58-5 C9H8Cl2O3.H2O 253.08 ethyl3,5-dichloro-4-hydroxybenzoate; hydrate; 207291-58-5; ETHYL3,5-DICHLORO-4-HYDROXYBENZOATEHYDRATE,98%; Ethyl3,5-dichloro-4-hydroxybenzoatehydrate; CTK4E4952
Ethyl 3,5-dichloro-4-hydroxybenzoate 17302-82-8 C9H8Cl2O3 235.06 RARECHEM AL BI 0933; 3,5-DICHLORO-4-HYDROXYBENZOIC ACID ETHYL ESTER; LABOTEST-BB LT00455658; ETHYL 3,5-DICHLORO-4-HYDROXYBENZOATE; 3,5-dichloro-4-hydroxy-benzoicaciethylester; ethyl3,5-dlchloro-4-hydroxybenzoate
Ethyl 3,5-dibromo-4-hydroxybenzoate 55771-81-8 C9H8Br2O3
Ethyl 3,5-dibromo-1H-indole-2-carboxylate 77185-78-5 C11H9Br2NO2 347.00
ETHYL 3,5-BIS(TRIFLUOROMETHYL)PHENYL ACETATE 144632-97-3 C12H10F6O2 300.2 ETHYL 3,5-BIS(TRIFLUOROMETHYL)PHENYL ACETATE; 3,5-BIS(TRIFLUOROMETHYL)PHENYL ACETATE; 3,5-BIS(TRIFLUOROMETHYL)PHENYLACETIC ACID ETHYL ESTER; Ethyl 3,5-Bis(trifluoromethyl)phenyl acetate 97%; Ethyl3,5-Bis(trifluoromethyl)phenylacetate97%
ETHYL 3,5-BIS(TRIFLUOROMETHYL)BENZOATE 96617-71-9 C11H8F6O2 286.17 ETHYL 3,5-BIS(TRIFLUOROMETHYL)BENZOATE; RARECHEM AL BI 0207; 3,5-Bis(trifluoromethyl)benzoic acid ethyl ester; Ethyl 3,5-bis(trifluoromethyl)benzoate,97%
Ethyl 3,4-Dimethyl-1H-pyrrole-2-carboxylate 938-75-0 C9H13NO2 167.2090 Ethyl 3,4-Dimethyl-1H-pyrrole-2-carboxylate
ethyl 3-(trifluoromethyl)butyrate 95853-67-1 C7H11F3O2 184.15 ETHYL 3-METHYL-4,4,4-TRIFLUOROBUTYRATE; ETHYL 3-(TRIFLUOROMETHYL)BUTYRATE; Ethyl 3-methyl-4,4,4-trifluorobutyrate 97%; Ethyl3-methyl-4,4,4-trifluorobutyrate97%
Ethyl 3-(trifluoromethoxy)benzoate 677713-01-8 C10H9 F3 O3 234.17200
Ethyl 3-(tetrahydrofuran-3-yl)-3-oxopropanoate 324570-25-4 C9H14O4 186.2 ETHYL 3-(TETRAHYDROFURAN-3-YL)-3-OXOPROPANOATE; ETHYL-3-TETRAHYDROFURFUROYL-ACETATE; EETHYL 3-(TETRAHYDROFURAN-3-YL)-3-OXOPROPANOATE
ETHYL 3-(TERT-BUTYL)-1-(4-FLUOROBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE 306936-98-1 C17H21FN2O2 304.36 ETHYL 3-(T-BUTYL)-1-(4-FLUOROBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE; ETHYL 3-(TERT-BUTYL)-1-(4-FLUOROBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE; Ethyl3-tert-butyl-1-(4-fluorobenzyl)-1H-pyrazole-5-carboxylate97%
ETHYL 3-(TERT-BUTYL)-1-(3-METHYLBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE 306936-95-8 C18H24N2O2 300.4 ETHYL 3-(TERT-BUTYL)-1-(3-METHYLBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE
ETHYL 3-(TERT-BUTYL)-1-(2,4-DICHLOROBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE 306936-96-9 C17H20Cl2N2O2 355.26 306936-96-9; ethyl5-tert-butyl-2-[(2,4-dichlorophenyl)methyl]pyrazole-3-carboxylate; ETHYL3-(TERT-BUTYL)-1-(2,4-DICHLOROBENZYL)-1H-PYRAZOLE-5-CARBOXYLATE; ZINC02381249; AC1MC7B9; CTK4G5709
ETHYL 3-(PYRROLIDIN-3-YL)PROPANOATE 748797-09-3 C9H17NO2 171.24 ETHYL 3-(PYRROLIDIN-3-YL)PROPANOATE
ethyl 3-(piperazin-1-yl)propanoate 43032-38-8 C9H18N2O2 186.25 3-(PIPERAZIN-1-YL)PROPIONIC ACID ETHYL ESTER; Ethyl 3-piperazin-1-ylpropanoate; 3-(PIPERAZIN-1-YL)-PROPIONIC ACID ETHYL ESTER >98%
ETHYL 3-(METHYLTHIO)BUTYRATE 233665-96-8 C7H14O2S 162.25 ETHYL 3-(METHYLTHIO)BUTYRATE; RARECHEM AL BI 0268
Ethyl 3-(methylsulfanyl)-5-oxo-2,5-dihydro-1,2,4-triazine-6-carboxylate 31143-85-8
Ethyl 3-(benzyloxy)cyclobutanecarboxylate 106596-81-0 C14H18O3 234.29100 Ethyl 3-(benzyloxy)cyclobutanecarboxylate; 3-(Phenylmethoxy)-cyclobutanecarboxylic acid ethyl ester
ETHYL 3'-(AMINOMETHYL)BIPHENYL-4-CARBOXYLATE 479645-82-4 C16H17NO2 255.31 ETHYL 3'-(AMINOMETHYL)BIPHENYL-4-CARBOXYLATE
ETHYL 3-(6-CHLOROIMIDAZO[2,1-B][1,3]THIAZOL-5-YL)-2-CYANOACRYLATE 265307-86-6 C11H8ClN3O2S 281.72 RARECHEM AL BR 0972; ETHYL 3-(6-CHLOROIMIDAZO[2,1-B][1,3]THIAZOL-5-YL)-2-CYANOACRYLATE
ETHYL 3-(6-BROMOPYRIDIN-2-YL)-3-OXOPROPANOATE 916791-38-3 C10H10BrNO3 272.1 ETHYL 3-(6-BROMOPYRIDIN-2-YL)-3-OXOPROPANOATE; 6-BROMO-BETA-OXO-2-PYRIDINEPROPANOIC ACID ETHYL ESTER; ETHYL 3-(6-BROMOPYRIDIN-2-YL)-3-OXOPROPIONATE
Ethyl 3-(5-amino-3-methyl-1H-pyrazol-1-yl)benzoate 903567-11-3 C13H15N3O2 245.28
ETHYL 3-(4-MORPHOLINO)PROPIONATE 20120-24-5 C9H17NO3 187.24 ETHYL 3-MORPHOLIN-4-YLPROPANOATE; ETHYL 3-(4-MORPHOLINO)PROPIONATE; AKOS BB-8701; 3-(4-Morpholino)propionic acid ethyl ester; ethyl 4-morpholinepropionate; 3-Morpholinopro
ETHYL 3-(4-METHYL-1H-PYRROL-3-YL)PROPANOATE 132281-90-4
ETHYL 3-(4-METHOXYPHENYL)-1-METHYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-51-2 C14H16N2O3 260.29 ETHYL 3-(4-METHOXYPHENYL)-1-METHYL-1H-PYRAZOLE-5-CARBOXYLATE; SALOR-INT L201391-1EA
ETHYL 3-(4-METHOXYBENZOYL)PROPIONATE 15118-67-9 C13H16O4 236.26 ETHYL 4-(4-METHOXYPHENYL)-4-OXOBUTANOATE; ETHYL 4-(4-METHOXYPHENYL)-4-OXOBUTYRATE; ETHYL 3-(4-METHOXYBENZOYL)PROPIONATE; 4-(4-METHOXY-PHENYL)-4-OXO-BUTYRIC ACID ETHYL ESTER; Ethyl 4-oxo-4-(4-methoxyphenyl)butyrate~3-(4-Methoxybenzoyl)propionic acid ethyl
ETHYL 3-(4-FORMYLPHENYL)PROPANOATE 445483-72-7 C12H14O3 206.24 ETHYL 3-(4-FORMYLPHENYL)PROPANOATE; Benzenepropanoic acid, 4-formyl-, ethyl ester (9CI)
ETHYL 3-(4-FLUOROPHENYL)-2-(2-METHYLPROPIONYL)PROPENOATE-D6 1185241-64-8 C15H11D6FO3 270.329053868 ETHYL 3-(4-FLUOROPHENYL)-2-(2-METHYLPROPIONYL)PROPENOATE-D6
ETHYL 3-(4-CHLOROANILINE)-2-(2,5-DIOXOTETRAHYDROFURAN-3-YL)BUT-2-ENOATE 216876-53-8 C16H16ClNO5 337.75 ETHYL 3-(4-CHLOROANILINE)-2-(2,5-DIOXOTETRAHYDROFURAN-3-YL)BUT-2-ENOATE; ETHYL 3-(4-CHLOROANILINO)-2-(2,5-DIOXOTETRAHYDROFURAN-3-YL)BUT-2-ENOATE
ETHYL 3-(4-BROMOPHENYL)-1-METHYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-50-1 C13H13BrN2O2 309.16 ETHYL 3-(4-BROMOPHENYL)-1-METHYL-1H-PYRAZOLE-5-CARBOXYLATE; SALOR-INT L201383-1EA
ETHYL 3-(4-BROMOPHENYL)-1H-PYRAZOLE-5-CARBOXYLATE 948292-48-6 C12H11BrN2O2 295.13 ETHYL 3-(4-BROMOPHENYL)-1H-PYRAZOLE-5-CARBOXYLATE
Ethyl 3-(4-bromophenyl)-1,2,4-oxadiazole-5-carboxylate 861146-12-5 C11H9BrN2O3 0 Ethyl 3-(4-bromophenyl)-1,2,4-oxadiazole-5-carboxylate
Ethyl 3-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl) propionate 302577-73-7 C11H21BO4 228.09 Ethyl 3-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl) proprionate; Ethyl 3-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl) propionate; 2-(Ethoxycarbonyl)ethylboronic acid,pinacol ester
ETHYL 3-(4-(AMINOMETHYL)PHENYL)PROPANOATE 93071-68-2 C12H17NO2 207.27 ETHYL 3-(4-(AMINOMETHYL)PHENYL)PROPANOATE
ETHYL 3-(3-TERT-BUTOXY-3-OXOPROPYLAMINO)-2-(N-BOC-AMINO)-3-OXOPROPANOATE 1076200-11-7 C17H30N2O7 374.4293 ETHYL 3-(3-TERT-BUTOXY-3-OXOPROPYLAMINO)-2-(N-BOC-AMINO)-3-OXOPROPANOATE
ETHYL 3-(3-FORMYLPHENYL)PROPANOATE 110114-05-1 C12H14O3 206.24 ETHYL 3-(3-FORMYLPHENYL)PROPANOATE
ETHYL 3-(3-CYANOPHENYL)PROPANOATE 10036-20-1 C12H13NO2 203.24 ETHYL 3-(3-CYANOPHENYL)PROPANOATE
Ethyl 3-(3-chlorophenyl)-[1,2,4]oxadiazole-5-carboxylate 478030-49-8 C11H9ClN2O3 252.66
ETHYL 3-(3,4-DIMETHOXYPHENYL)PROPIONATE 63307-08-4 C13H18O4 238.28 ETHYL 3-(3,4-DIMETHOXYPHENYL)PROPIONATE; 3-(2,3-DIMETHOXY-PHENYL)-PROPIONIC ACID ETHYL ESTER; 3-(3,4-DIMETHOXY-PHENYL)-PROPIONIC ACID ETHYL ESTER
ethyl 3-(3,4-dihydroquinolin-1(2H)-yl)-2-oxopropanoate 152712-44-2
ethyl 3-(3,4-dichlorophenyl)-3-oxopropanoate 53090-43-0 C11H10Cl2O3 261.1013;g/mol ethyl3-(3,4-dichlorophenyl)-3-oxopropanoate; 53090-43-0; ZINC02575928; AC1MBXKC; SCHEMBL1348885; CTK4J7046
ETHYL 3-(3,4,5-TRIMETHOXYPHENYL)PROPIONATE 70311-20-5 C14H20O5 268.31 LABOTEST-BB LT01148149; ETHYL 3,4,5-TRIMETHOXYPHENYL PROPIONATE; ETHYL 3-(3,4,5-TRIMETHOXYPHENYL)PROPIONATE; 3-(3,4,5-TRIMETHOXY-PHENYL)-PROPIONIC ACID ETHYL ESTER; 3,4,5-Trimethoxybenzenepropionic acid ethyl ester
ETHYL 3-(2-CARBOXY-VINYL)-5-NITRO-1H-INDOLE-2-CARBOXYLATE 885273-59-6 C14H12N2O6 304.25 ETHYL 3-(2-CARBOXY-VINYL)-5-NITRO-1H-INDOLE-2-CARBOXYLATE
ETHYL 3-(2-CARBOXY-VINYL)-5-FLUORO-1H-INDOLE-2-CARBOXYLATE 885273-65-4 C14H12FNO4 277.25 ETHYL 3-(2-CARBOXY-VINYL)-5-FLUORO-1H-INDOLE-2-CARBOXYLATE
ETHYL 3-(2-CARBOXY-VINYL)-5-CHLORO-1H-INDOLE-2-CARBOXYLATE 885273-63-2 C14H12ClNO4 293.7 ETHYL 3-(2-CARBOXY-VINYL)-5-CHLORO-1H-INDOLE-2-CARBOXYLATE
ETHYL 3-(2,6-DIMETHOXYPHENYL)-3-OXOPROPANOATE 125732-13-0 C13H16O5 252.26 ETHYL 3-(2,6-DIMETHOXYPHENYL)-3-OXOPROPANOATE
Ethyl 3-(2,6-dichloropyridin-3-yl)-3-oxopropanoate 174727-36-7 C10H9Cl2NO3 262.09 ETHYL 3-(2,6-DICHLOROPYRIDIN-3-YL)-3-OXOPROPANOATE
Ethyl 3-(2,6-dichlorophenyl)-5-methyl-4-isoxazole carboxalate 24248-21-3 C13H11Cl2NO3 300.14 ETHYL 3-(2,6-DICHLORO-PHENYL)-5-METHYL-ISOXAZOLE-4-CARBOXYLATE; Ethyl3-(2,6-dichlorophenyl)-5-methyl-4-isoxazolecarboxalate; 3-(2,6-Dichlorophenyl)-5-methyl-4-isoxazolecarboxylic acid ethyl ester; 3-(2,6-dichlorophenyl)-5-methyl-isoxazole-4-carboxylic aci
ETHYL 3-(2,4,5-TRIFLUORO-3-METHYLPHENYL)-3-OXOPROPANOATE 112822-88-5 C12H11F3O3 260.2091496 ETHYL 3-(2,4,5-TRIFLUORO-3-METHYLPHENYL)-3-OXOPROPANOATE; ETHYL 3-OXO-3-(2,4,5-TRIFLUORO-3-METHYLPHENYL)PROPANOATE 2,4,5-TRIFLUORO-3-METHYL-SS-OXO,BENZENEPROPANOIC ACID,ETHYL ESTER
ethyl 3-(1-(3-chlorophenyl)-2-ethoxy-2-oxoethylthio)propanoate 41022-14-4 C15H19ClO4S 330.82696;g/mol ethyl3-[1-(3-chlorophenyl)-2-ethoxy-2-oxoethyl]sulfanylpropanoate;41022-14-4;CTK4I4153;OR068174;Benzeneaceticacid,3-chloro-a-[(3-ethoxy-3-oxopropyl)thio]-,ethylester;ETHYL3-{[1-(3-CHLOROPHENYL)-2-ETHOXY-2-OXOETHYL]SULFANYL}PROPANOATE
ethyl 3-(1-(2-chlorophenyl)-2-ethoxy-2-oxoethylthio)propanoate 41022-44-0 C15H19ClO4S 330.82696;g/mol ethyl3-[1-(2-chlorophenyl)-2-ethoxy-2-oxoethyl]sulfanylpropanoate;41022-44-0;CTK4I4155;OR068173;Benzeneaceticacid,2-chloro-a-[(3-ethoxy-3-oxopropyl)thio]-,ethylester;ETHYL3-{[1-(2-CHLOROPHENYL)-2-ETHOXY-2-OXOETHYL]SULFANYL}PROPANOATE
ETHYL 2-TRIFLUOROMETHYLIMIDAZO[1,2-A]PYRIDINE-3-CARBOXYLATE 108438-46-6 C11H9F3N2O2 258.2 ETHYL 2-TRIFLUOROMETHYLIMIDAZO[1,2-A]PYRIDINE-3-CARBOXYLATE; BUTTPARK 87\01-89
ETHYL 2-THIOCYANATOACETATE 5349-28-0 C5H7NO2S 145.18
ETHYL 2-THIEN-2-YL BENZOATE 6072-48-6 C13H12O2S 232.3 RARECHEM AL BI 1415; ETHYL 2-THIEN-2-YL BENZOATE; Ethyl 2-thien-2-ylbenzoate 97%
Ethyl 2-sulfamoylbenzoate 59777-72-9 C9H11NO4S 229.25 O-CARBOETHOXYBENZENE SULFONAMIDE; 2-SULFONAMIDOBENZOIC ACID ETHYL ESTER; 2-SULFAMOYLBENZOIC ACID ETHYL ESTER; 2-Ethylcarbonylbenzene sulfonamide; 2-CARBOETHOXYBENZENE SULFONAMIDE; 2-(AMINOSULFONYL)BENZOIC ACID ETHYL ESTER; ETHYL 2-SULFAMOYLBENZOATE; ETHYL
ETHYL 2-PYRROL-1-YL-BENZATE 78540-08-6 C13H13NO2 215.25 ETHYL 2-PYRROL-1-YL-BENZATE
Ethyl 2-pyridylacetate hydrochloride 1205073-53-5 C9H12ClNO2 201.65
ETHYL 2-PYRIDINEGLYOXYLATE 55104-63-7 C9H9NO3 179.17 ETHYL 2-PYRIDINEGLYOXYLATE; ETHYL PICOLINOYLFORMATE
ETHYL 2-PROPYLPENTANOATE 17022-31-0 C10H20O2 172.26 ETHYL 2-PROPYLPENTANOATE; valproic acid ethyl ester; Ethyl dipropylacetate; Ethyl valproate; Pentanoic acid, 2-propyl-, ethyl ester
Ethyl 2-propylacetoacetate 1540-28-9 C9H16O3 172.22 2-ACETYL-PENTANOIC ACID ETHYL ESTER; ETHYL 2-N-PROPYLACETOACETATE; ethyl 2-propylacetoacetate; 2-Propylacetoacetic acid ethyl ester; 2-Acetylvaleric acid ethyl ester; ethyl 2-acetylpentanoate; ethyl 2-ethanoylpentanoate
Ethyl 2-piperazinobenzoate 180417-98-5 C13H18N2O2 234.29422;g/mol Ethyl 2-piperazinobenzoate; 2-(1-Piperazinyl)benzoic acid ethyl ester
Ethyl 2-piperazinecarboxylate 89941-07-1 C7H14N2O2 158.20 ETHYL-2-PIPERAZINECARBOXYLATE; 2-Piperazinecarboxylicacid,ethylester(6CI,7CI,9CI); ETHYL PIPERAZINE-2-CARBOXYLATE
ETHYL 2-PIPERAZINE-4-PHENYL THIAZOLE-5-CARBOXYLATE 206555-97-7 C16H19N3O2S 317.41 ETHYL 2-PIPERAZINO-4-PHENYL-THIAZOLE-5-CARBOXYLATE; ETHYL 2-PIPERAZINE-4-PHENYL THIAZOLE-5-CARBOXYLATE; 5-THIAZOLECARBOXYLIC ACID, 4-PHENYL-2-(1-PIPERAZINYL)-, ETHYL ESTER
ETHYL 2-PIPERAZINE-4-METHYL THIAZOLE-5-CARBOXYLATE 905807-72-9 C11H17N3O2S 255.34 ETHYL 2-PIPERAZINO-4-METHYL-THIAZOLE-5-CARBOXYLATE; ETHYL 2-PIPERAZINE-4-METHYL THIAZOLE-5-CARBOXYLATE; 5-THIAZOLECARBOXYLIC ACID, 4-METHYL-2-(1-PIPERAZINYL)-, ETHYL ESTER
Ethyl 2-phenylthiazole-4-carboxylate 59937-01-8 C12H11NO2S 233.28600 Ethyl 2-phenylthiazole-4-carboxylate; 2-Phenyl-4-thiazolecarboxylic acid ethyl ester
ETHYL 2-PHENYL-IMIDAZOLE-4-CARBOXYLATE 32683-00-4 C12H12N2O2 216.24 RARECHEM AL BI 1033; ETHYL 2-PHENYL-IMIDAZOLE-4-CARBOXYLATE
ETHYL 2-PHENYLIMIDAZO[1,2-A]PYRIDINE-3-CARBOXYLATE 119448-82-7 C16H14N2O2 266.29 ETHYL 2-PHENYLIMIDAZO[1,2-A]PYRIDINE-3-CARBOXYLATE; BUTTPARK 7\05-100
Ethyl 2-phenylacetoacetate 5413-05-8 C12H14O3 206.24 ETHYL 3-OXO-2-PHENYLBUTANOATE; ETHYL 2-PHENYLACETOACETATE; 2-Phenylacetoacetic acid ethyl ester; Benzeneacetic acid, .alpha.-acetyl-, ethyl ester; 2-Phenyl-3-oxobutanoic acid ethyl ester; 2-Phenyl-3-oxobutyric acid ethyl ester
Ethyl 2-phenyl-2-piperidinoacetate 7550-06-3 C15H21NO2 247.34
Ethyl 2-oxothiane-3-carboxylate 4547-45-9 C8H12O3S 188.24 ETHYL 2-OXOTHIANE-3-CARBOXYLATE
Ethyl 2-oxohexanoate 5753-96-8 C8H14O3 158.2
ETHYL 2-OXO-4-PYRIDIN-3-YL-BUTYRATE 478282-34-7 C11H13NO3 207.22582 ETHYL 2-OXO-4-PYRIDIN-3-YL-BUTYRATE
ETHYL 2-OXO-4-PHENYLBUTYRATE D5 1189911-53-2 C12H5D5O3 207.23680889 ETHYL 2-OXO-4-PHENYLBUTYRATE D5
Ethyl 2-oxo-3-phenylcyclopentanecarboxylate 312312-75-7 C14H16O3 Ethyl 2-oxo-3-phenylcyclopentanecarboxylate; 2-Oxo-3-phenyl-cyclopentanecarboxylic acid ethyl ester
ETHYL 2-OXO-3-(2-OXOCYCLOPENTYL)PROPANOATE 175157-15-0 C10H14O4 198.21576 ETHYL 2-OXO-3-(2-OXOCYCLOPENTYL)PROPANOATE
Ethyl 2-oxo-2,3-dihydrooxazole-4-carboxylate 874827-32-4 C6H7NO4 0 Ethyl 2-oxo-2,3-dihydrooxazole-4-carboxylate
ETHYL 2-OCTYNOATE 10519-20-7 C10H16O2 168.23 ETHYL 2-OCTYNOATE; 2-OCTYNOIC ACID ETHYL ESTER; TIMTEC-BB SBB008812; Ethyl heptyne carboxylate; RARECHEM AL BI 0742; ethyl oct-2-ynoate
ethyl 2-ethoxybenzoate 6290-24-0 C11H14O3 194.23 RARECHEM AL BI 0028; 2-ETHOXYBENZOIC ACID ETHYL ESTER; ETHYL 2-ETHOXYBENZOATE
Ethyl 2-ethoxy-8-ethyl-5,8-dihydro-5-oxopyrido[2,3-d]pyrimidine-6-carboxylate 79614-51-0 C14H17N3O4 291.3025
Ethyl 2-ethoxy-2-hydroxyacetate 49653-17-0 C6H12O4 148.16 GLYOXYLIC ACID ETHYL ESTER ETHYL HEMIACETAL; ETHYL 2-ETHOXY-2-HYDROXYACETATE; GEHA; ethyl ethoxyhydroxyacetate; Ethoxyhydroxy-acetic Acid Ethyl Ester; Ethyl 2-Ethoxyglycolate
ETHYL 2-AMINO-2-METHYLPENTANOATE 13893-47-5 C8H17NO2 159.23 ETHYL 2-AMINO-2-METHYLPENTANOATE
ETHYL 2-AMINO-2-METHYLBUTYRATE 56247-82-6 C7H15NO2 145.2 ETHYL 2-AMINO-2-METHYLBUTYRATE; DL-Isovaline ethyl ester; E80073
ETHYL 2-AMINO-2-METHYLBUTYRATE 13893-46-4 C7H15NO2 145.2 ETHYL (S)-2-AMINO-2-METHYLBUTYRATE
ETHYL 2-AMINO-2-ETHYLOCTANOATE 164262-28-6 C12H25NO2 215.33 ETHYL 2-AMINO-2-ETHYLOCTANOATE; 2-Amino-2-ethyloctanoic acid ethyl ester
ETHYL 2-AMINO-1-CYANO-5,6,7,8-TETRAHYDROINDOLIZINE-3-CARBOXYLATE 132994-04-8 C12H15N3O2 233.27 ETHYL 2-AMINO-1-CYANO-5,6,7,8-TETRAHYDROINDOLIZINE-3-CARBOXYLATE
Ethyl 2-allyl-2-cyano-3-methylhexanoate 33422-23-0 C13H21NO2 223.31 ETHYL 2-ALLYL-2-CYANO-3-METHYLHEXANOATE; ETHYL-2-CYANO-3-METHYL-2-(2-PROPENYL) HEXANOATE
ethyl 2-(ethylamino)acetate 3183-20-8 C6H13NO2 131.17
ethyl 2-(dimethylamino)-1-phenylcyclohex-3-ene-1-carboxylate hydrochloride 24357-97-9 309.835
Ethyl 2-(diethoxyphosphoryl)prop-2-enoate 20345-61-3 C9 H17 O5 P 236.21
Ethyl 2-(diethoxyphosphoryl)-3-methylbutanoate 35051-50-4 C11H23O5P 266.27 2-(DIETHOXYPHOSPHINYL)-3-METHYLBUTANOIC ACID ETHYL ESTER; DIETHYL[1-(ETHOXYCARBONYL)-2-METHYLPROPYL]PHOSPHONATE; Diethyl[1-(ethoxycarbonyl)-2-methylpropyl]phosphonate, 97 %
ethyl 2-(anilinocarbonyl)hydrazinecarboxylate 17696-94-5 C10H13N3O3 2-[(Phenylamino)carbonyl]hydrazinecarboxylic acid ethyl ester; 4-Phenyl-1-carbethoxysemicarbazide
ethyl 2-(acetyloxy)-6-[(E)-2-[3,4-bis(acetyloxy)phenyl]ethenyl]benzoate 365543-22-2 C23H22O8 426.416
ethyl 2-(8-(3,5-difluorophenyl)-10-oxo-6,9-diazaspiro[4.5]decan-9-yl)acetate 957122-10-0 C18H22F2N2O3 352.37600
Ethyl 2-(6-bromoimidazo[1,2-a]pyridin-3-yl)acetate 603311-76-8 C11H11BrN2O2 283.12 ethyl 2-(6-bromoH-imidazo[1,2-a]pyridin-3-yl)acetate; Ethyl 2-(6-bromoimidazo[1,2-a]pyridin-3-yl)acetate; 2-(6-Bromoimidazo[1,2-a]pyridin-3-yl)acetic acid ethyl ester
ethyl 2-(6-aminopyridin-2-yl)acetate 71469-82-4 C9H12N2O2 180.20
ETHYL 2-(5-TETRAHYDRO-1H-PYRROL-1-YL-2H-1,2,3,4-TETRAAZOL-2-YL)ACETATE 175205-06-8 C9H15N5O2 225.25 ETHYL 5-(1-PYRROLIDINO)TETRAZOL-2-YLACETATE; ETHYL 2-(5-TETRAHYDRO-1H-PYRROL-1-YL-2H-1,2,3,4-TETRAAZOL-2-YL)ACETATE; BUTTPARK 1\01-17; ETHYL (5-(PYRROLIDINO)TETRAZOL-2-YL)ACETATE
ETHYL 2-(5-PHENYL-2H-1,2,3,4-TETRAAZOL-2-YL)ACETATE 21054-65-9 C11H12N4O2 232.24 BUTTPARK 2\01-87; ETHYL 2-(5-PHENYL-2H-1,2,3,4-TETRAAZOL-2-YL)ACETATE
Ethyl 2-(5-Methylisoxazol-3-Yl)acetate 60148-50-7 C7H9NO3 169.17800
ETHYL 2-(5-METHYLISOXAZOL-3-YL)-1,3-THIAZOLE-4-CARBOXYLATE, 97 175277-28-8 C10H10N2O3S 238.263 ETHYL 2-(5-METHYLISOXAZOL-3-YL)-1,3-THIAZOLE-4-CARBOXYLATE, 97; Ethyl 2-(5-methylisoxazol-3-yl)-1,3-thiazole-4-carboxylate; ETHYL 2-(5-METHYLISOXAZOL-3-YL)THIAZOLE-4-CARBOXYLATE
Ethyl 2-(5-Methyl-4H-1,2,4-Triazol-3-yl)acetate 100187-10-8 C7H11N3O2 169.18 ethyl 2-(5-methyl-4H-1,2,4-triazol-3yl)acetate; 5-Methyl-1H-1,2,4-triazole-3-acetic acid ethyl ester
ethyl 2-(5-bromo-2-thienyl)-2-oxoacetate 22098-10-8 C8H7BrO3S 263.10 ETHYL (5-BROMOTHIEN-2-YL)GLYOXYLATE; ETHYL 2-(5-BROMO-2-THIENYL)-2-OXOACETATE; Ethyl (5-bromothien-2-yl)glyoxylate 97%; ETHYL 2-(5-BROMOTHIEN-2-YL)GLYOXYLATE
Ethyl 2-(5-bromo-2-methylphenyl)-2,2-difluoroacetate 1226808-72-5 C11H11BrF2O2 0 Ethyl 2-(5-bromo-2-methylphenyl)-2,2-difluoroacetate
Ethyl 2-(4-piperidyl)acetate hydrochloride 169458-04-2 C9H17NO2.ClH 207.7
ETHYL 2-(4-CHLOROPHENYL)-4-HYDROXY-1,3-THIAZOLE-5-CARBOXYLATE 263016-08-6 C12H10ClNO3S 283.73 ETHYL 2-(4-CHLOROPHENYL)-4-HYDROXY-1,3-THIAZOLE-5-CARBOXYLATE; ETHYL 2-(4-CHLOROPHENYL)-4-HYDROXYTHIAZOLE-5-CARBOXYLATE
Ethyl 2-(4-chlorophenoxy)acetate 14426-42-7 C10H11ClO3 214.65 (4-CHLOROPHENOXY) ACETIC ACID ETHYL ESTER; ETHYL(4-CHLOROPHENOXY)ACETATE; 4-CHLORO ETHYLPHENOXYACETATE; Ethyl 2-(4-chlorophenoxy)acetate
ethyl 2-(4-bromophenyl)-2,2-difluoroacetate 1004305-97-8 C10H9BrF2O2 0 ethyl 2-(4-bromophenyl)-2,2-difluoroacetate
ETHYL 2-(4-AMINO-3-METHOXYPHENYL)-3,3,3-TRIFLUORO-2-HYDROXYPROPANOATE 254732-50-8 C12H14F3NO4 293.24 2-(4-AMINO-3-METHOXY-PHENYL)-3,3,3-TRIFLUORO-2-HYDROXY-PROPIONIC ACID ETHYL ESTER; ETHYL 2-(4-AMINO-3-METHOXYPHENYL)-3,3,3-TRIFLUORO-2-HYDROXYPROPANOATE
Ethyl 2-(4-acetamidophenyl)sulfonylacetate 88881-74-7 C12H15NO5S 285.32
ETHYL 2-(3-OXO-3,4-DIHYDRO-2H-1,4-BENZOTHIAZIN-2-YL) ACETATE 82191-17-1 C12H13NO3S 251.3 BUTTPARK 46\04-03; ETHYL 2-(3-OXO-3,4-DIHYDRO-2H-1,4-BENZOTHIAZIN-2-YL) ACETATE; Ethyl 2-(3-oxo-3,4-dihydro-2H-1,4-benzothiazin-; 2,3-DIHYDRO-2-(ETHOXYCARBONYLMETHYL)-4H-BENZO-1,4-THIAZIN-3-ONE
ETHYL 2-(3-N-PHTHALIMIDOPROPYL)ACETOACETATE 55747-45-0 C17H19NO5 317.34 ETHYL 2-(3-N-PHTHALIMIDOPROPYL)ACETOACETATE; Ethyl acetopropylphthalimide; ETHYL-2-ACETYL-5-PHTHALIMIDO PENTANOATE; Ethyl-2-acetyl-5-Phthalimidopentanorate; Ethy2-(3-N-phthalimidopropyl)acetoacetate; Ethyl-2-acetyl-5-(1,3-oxo-2,3-dihydro-1H-2-isoindolyl)
ETHYL 2-(3-HYDROXY-2-OXOPYRAZIN-1(2H)-YL)ACETATE 312904-87-3 C8H10N2O4 198.18 ETHYL 2-(3-HYDROXY-2-OXOPYRAZIN-1(2H)-YL)ACETATE; (3-Hydroxy-2-oxo-2H-pyrazin-1-yl)-acetic acid ethyl ester
Ethyl 2-(3-fluoro-4-nitrophenyl)propionate 78543-07-4 C11H12FNO4 241.21 ETHYL 2-(3-FLUORO-4-NITROPHENYL)PROPIONATE
ETHYL 2-(3-CHLORO-4-NITROPHENYL)PROPIONATE 50537-08-1 C11H12ClNO4 0 ETHYL 2-(3-CHLORO-4-NITROPHENYL)PROPIONATE
Ethyl 2-(3-chloro-2-methylphenyl)-2,2-difluoroacetate 1215205-45-0 C11H11ClF2O2 0 Ethyl 2-(3-chloro-2-methylphenyl)-2,2-difluoroacetate
Ethyl 2-(3-bromo-4-isobutoxyphenyl)- 4-methyl-5-thiazolecarboxylate 144060-96-8 C17H20BrNO3S 398.31
Ethyl 2-(3,5-dichlorophenyl)thiazole-4-carboxylate 132089-38-4 C12H9Cl2NO2S 302.17636;g/mol Ethyl2-(3,5-dichlorophenyl)thiazole-4-carboxylate; 132089-38-4; ethyl2-(3,5-dichlorophenyl)-1,3-thiazole-4-carboxylate; SBB066489; 4-Thiazolecarboxylicacid,2-(3,5-dichlorophenyl)-,ethylester; ACMC-209zp8
Ethyl 2-(2-pyridinyl)-DL-glycinate 55243-15-7 C9H12N2O2 180.2
Ethyl 2-(2-Piperidyl)acetate 2739-99-3 C9H17NO2 171.23678;g/mol ethyl2-(2-piperidyl)acetate;ETHYLPIPERIDIN-2-YLACETATE;2739-99-3;Ethyl2-(piperidin-2-yl)acetate;ETHYL2-PIPERIDINEACETATE;SEJLPOWVAACXJQ-UHFFFAOYSA-N
ETHYL 2-(2-PHENYL-1,3-THIAZOL-4-YL)BENZENECARBOXYLATE 65349-17-9 C18H15NO2S 309.38 ETHYL 2-(2-PHENYL-1,3-THIAZOL-4-YL)BENZENECARBOXYLATE
Ethyl 2-(2-mercapto-4-methyl-1,3-thiazol-5-yl)acetate 111874-19-2 C8H11NO2S2 217.31 Ethyl 2-(2-mercapto-4-methyl-1,3-thiazol-5-yl)acetate; 2-Mercapto-4-methyl-5-thiazylethyl formate; 2-Sulfhydryl-4-methyl-5-thiazylethyl formate
ethyl 2-(2-chlorophenyl)acetate 40061-54-9 C10H11ClO2 198.64
Ethyl 2-(2-benzyloxycarbonylaminothiazol-4-yl) acetate 92592-02-4 C15H16N2O4S 320.36400
Ethyl 2-(2-aminothiazole-4-yl)-2-methoxyiminoacetate 64485-88-7 C8H11N3O3S 229.25 ETHYL (Z)-2-(2-AMINOTHIAZOL-4-YL)-2-METHOXYIMINOACETATE; ETHYL (Z)-2-(2-AMINO-4-THIAZOLYL)-2-METHOXYIMINOACETATE; ETHYL-2-METHOXY-AMINO-2-(2-AMINO-THIAZOLE-4-YL) ACETATE; ETHYL (2E)-2-(2-AMINO-1,3-THIAZOL-4-YL)-2-METHOXYIMINO-ACETATE; ETHYL 2-AMINO-ALPHA-
Ethyl 2-(2-aminothiazole-4-yl)-2-(1-tert-butoxycarbonyl-1-methylethoxyimino)acetate 86299-46-9 C15H23N3O5S 357.42 ATTBA; ETHYL (Z)-2-(TERT-BUTOXYCARBONYL METHOXYIMINO)-2-(2-AMINOTHIAZOL-4-YL) ACETATE; 2-(2-AMINOTHIAZOLE-4-YL)-2-[2-(TERTBUTOXYCARBONYL)ISOPROPOXYIMINO]ACETIC ACID; 2-Amino-alpha-[[2-(1,1-dimethyl-ethoxy)-1,1-dimethyl-2-oxo-ethoxy]imino]-, ethyl ester, 4
ETHYL 2-(2-[4-(TERT-BUTYL)PHENYL]-1,3-THIAZOL-4-YL)ACETATE 680215-69-4 C17H21NO2S 303.42 ETHYL 2-(2-[4-(TERT-BUTYL)PHENYL]-1,3-THIAZOL-4-YL)ACETATE
Ethyl 2-(2,6-dichlor-5-fluorpyridin-3-carbonyl)-3-(2,4-difluorphenylamino)acrylate 100490-99-1 C17H11Cl2F3N2O3 419.18205;g/mol ethyl(Z)-2-(2,6-dichloro-5-fluoropyridine-3-carbonyl)-3-(2,4-difluoroanilino)prop-2-enoate; Ethyl2-(2,6-dichlor-5-fluorpyridin-3-carbonyl)-3-(2,4-difluorphenylamino)acrylate; 100490-99-1; SCHEMBL5258270; ZINC100073926
Ethyl 2-(2,5-dichlorophenyl)-2,2-difluoroacetate 1215206-21-5 C10H8Cl2F2O2 0 Ethyl 2-(2,5-dichlorophenyl)-2,2-difluoroacetate
Ethyl 2-(2,4-dimethylthiazol-5-yl)acetate 405921-41-7 C9H13NO2S 199.27
ETHYL 2-(2,4-DIFLUOROPHENYL)THIAZOLE-4-CARBOXYLATE 175276-93-4 C12H9F2NO2S 269.27 BUTTPARK 82\50-54; ETHYL 2-(2,4-DIFLUOROPHENYL)THIAZOLE-4-CARBOXYLATE; ETHYL 2-(2,4-DIFLUOROPHENYL)-1,3-THIAZOLE-4-CARBOXYLATE; Ethyl 2-(2,4-difluorophenyl)thiazole-4-carboxylate 97%; Ethyl2-(2,4-difluorophenyl)thiazole-4-carboxylate97%; Ethyl 2-(2,4-difl
Ethyl 2-(2,4-difluorophenyl)-2,2-difluoroacetate 1228957-05-8 C10H8F4O2 0 Ethyl 2-(2,4-difluorophenyl)-2,2-difluoroacetate
Ethyl 2-(2,4-dichlorophenyl)-4-hydroxy-1,3-thiazole-5-carboxylate 262856-01-9 C12H9Cl2NO3S 318.18 Ethyl 2-(2,4-dichlorophenyl)-4-hydroxy-1,3-thiazole-5-carboxylate; Ethyl 2-(2,4-dichlorophenyl)-4-hydroxythiazole-5-carboxylate
ETHYL 2-(2,4-DICHLORO-6-FORMYLPHENOXY)ACETATE 16861-40-8 C11H10Cl2O4 277.1 BUTTPARK 147\15-69; ETHYL 2-(2,4-DICHLORO-6-FORMYLPHENOXY)ACETATE
ETHYL 2-(1-OXO-4-PHENYLPHTHALAZIN-2(1H)-YL)ACETATE 296876-23-8 C18H16N2O3 308.33 ETHYL 2-(1-OXO-4-PHENYLPHTHALAZIN-2(1H)-YL)ACETATE; SALOR-INT L449067-1EA
ETHYL 2-(1H-PYRROL-1-YL)-1,3-BENZOTHIAZOLE-6-CARBOXYLATE 289651-81-6 C14H12N2O2S 272.32 6-(Ethoxycarbonyl)-2-(1H-pyrrol-1-yl)-1,3-benzothiazole
ethyl 2-(1H-benzimidazol-2-ylsulfanyl)acetate 5429-62-9 C11H12N2O2S 236.29 g/mol
Ethyl 2-(1-benzhydrylazetidin-3-ylidene) acetate 158602-32-5 C20H21NO2 307.39
ethyl 1-oxaspiro[2.5]octane-2-carboxylate 6975-17-3 C10H16O3 184.23 Ethyl-beta-beta-pentamethyleneglycidate; 1-Oxaspiro[2.5]octane-2-carboxylic acid ethyl ester
ethyl 1-nitro-4-oxo-4H-quinolizine-3-carboxylate 1556-30-5 C12H10N2O5 262.21
ethyl 1-naphthoylformate 33656-65-4 C14H12O3 228.24994
ethyl 1-naphthoate 3007-97-4 C13H12O2 200.23 ETHYL A-NAPHTHOATE; ETHYL ALPHA-NAPHTHOATE; ETHYL 1-NAPHTHOATE; ALPHA-NAPHTHOIC ACID ETHYL ESTER; RARECHEM AL BI 0090; 1-Naphthoic acid ethyl ester
ethyl 1-methylcyclopropanecarboxylate 71441-76-4 C7H12O2 128.17 ETHYL 1-METHYLCYCLOPROPANE-1-CARBOXYLATE; ethyl 1-methylcyclopropanecarboxylate; 1-METHYLCYCLOPROPANE-CARBOXYLIC ACID*ETH YL ESTER; ETHYL 1-METHYLCYCLOPROPAN-1-CARBOXYLATE
Ethyl 1-methyl-5-(difluoromethyl)-1H-pyrazole-4-carboxylate 851725-98-9 C8H10F2N2O2 204.175 Ethyl 1-methyl-5-(difluoromethyl)-1H-pyrazole-4-carboxylate
ethyl 1-methyl-4-phenylpiperidin-1-ium-3-carboxylate bromide 57193-93-8 C15H22BrNO2 328.245 g/mol
ethyl 1-methyl-4-nitro-1H-pyrrole-2-carboxylate 2853-29-4 C8H10 N2 O4 198.18 1-METHYL-4-NITRO-1H-PYRROLE-2-CARBOXYLIC ACID ETHYL ESTER; ETHYL 1-METHYL-4-NITRO-1H-PYRROLE-2-CARBOXYLATE
ETHYL 1-METHYL-3-P-TOLYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-49-8 C14H16N2O2 244.29 ETHYL 1-METHYL-3-P-TOLYL-1H-PYRAZOLE-5-CARBOXYLATE; SALOR-INT L201375-1EA; ETHYL 1-METHYL-3-(4-METHYLPHENYL)-1H-PYRAZOLE-5-CARBOXYLATE
Ethyl 1-methyl-3-ethyl-4-chloro-5-pyrazolecarboxylate 124800-34-6 C9H13ClN2O2 216.66 4-CHLORO-3-ETHYL-1-METHYL-1H-PYRAZOLE-5-CARBOXYLIC ACID ETHYL ESTER; Ethyl 4-chloro-3-ethyl-1-methyl -1H-pyrazole-5-carboxylate; Ethyl 1-methyl-3-ethyl-4-chloro-5-pyrazolecarboxylate
ethyl 1-methyl-1H-pyrazole-3-carboxylate 88529-79-7 C7H10N2O2 0 1H-Pyrazole-3-carboxylicacid,1-methyl-,ethylester(9CI)
ETHYL 1-METHYL-1H-INDAZOLE-3-CARBOXYLATE 220488-05-1 C11H12N2O2 204.23 ETHYL 1-METHYL-1H-INDAZOLE-3-CARBOXYLATE; methyl 1-methyl-1H-indazole-3-carboxylate
ETHYL 1-METHYL-1,2,3,6-TETRAHYDRO-4-PYRI DINECARBOXYLATE, TECH., 85 40175-06-2 C9H15NO2 169.223 ETHYL 1-METHYL-1,2,3,6-TETRAHYDRO-4-PYRI DINECARBOXYLATE, TECH., 85; ethyl 1-methyl-1,2,3,6-tetrahydro-4-pyridinecarbo; ETHYL 1-METHYL-1,2,3,6-TETRAHYDRO-4-PYRI DINECARBOXYLATE, TECH., 85%; 1-Methyl-1,2,3,6-tetrahydro-4-pyridinecarboxylic acid ethyl ester
Ethyl 1-isoquinolineacetate 46502-61-8 C13H13NO2 215.25 Ethyl 1-isoquinolineacetate; 1-Isoquinolineacetic acid ethyl ester
ETHYL 1-HYDROXYCYCLOPROPANECARBOXYLATE, 90 137682-89-4 C6H10O3 130.142 ETHYL 1-HYDROXYCYCLOPROPANECARBOXYLATE, 90
ETHYL 1-HYDROXYCYCLOPENTANE-CARBOXYLATE 41248-23-1 C8H14O3 158.19 ETHYL 1-HYDROXYCYCLOPENTANE-CARBOXYLATE; ETHYL2-HYDROXYCYCLOPENTANE; 1-Hydroxycyclopentanecarboxylic acid ethyl ester
ETHYL 1-HYDROXYCYCLOHEXANE-CARBOXYLATE 1127-01-1 C9H16O3 172.22 ETHYL 1-HYDROXYCYCLOHEXANE-CARBOXYLATE; Ethyl-1-hydroxycyclohexylacetate; 1-Hydroxycyclohexanecarboxylic acid ethyl ester; Ethyl 1-hydroxycyclohexane-1-carboxylate
Ethyl 1H-tetrazole-5-carboxylate sodium salt 96107-94-7 C4H5N4O2 164.09 Ethyl 1H-tetrazole-5-carboxylate sodium salt; 1H-Tetrazole-5-carboxylic acid ethyl ester sodium salt
ethyl 1H-pyrrolo[3,2-c]pyridine-4-carboxylate 1167056-36-1 C10H10N2O2
ethyl 1H-pyrrolo[2,3-c]pyridine-3-carboxylate 67058-73-5 C10H10N2O2
ethyl 1H-pyrazolo[3,4-c]pyridine-3-carboxylate 1053656-33-9 C9H9N3O2 0 ethyl 1H-pyrazolo[3,4-c]pyridine-3-carboxylate; 1H-Pyrazolo[3,4-c]pyridine-3-carboxylic acid ethyl ester
ethyl 1H-indazole-5-carboxylate 192944-51-7 C10H10N2O2 190.2 1H-INDAZOLE-5-CARBOXYLIC ACID ETHYL ESTER; ETHYL 1H-INDAZOLE-5-CARBOXYLATE; 1H-Indazole-5-carboxylicacid,ethylester(9CI)
ethyl 1H-1,2,3-triazole-4-carboxylate 40594-98-7 C5H7N3O2 141.13 3H-[1,2,3]TRIAZOLE-4-CARBOXYLIC ACID ETHYL ESTER; 1H-1,2,3-TRIAZOLE-4-CARBOXYLIC ACID, ETHYL ESTER; 1H-1,2,3-Triazole-4-carboxylicacid,ethylester(9CI); Ethyl 1H-1,2,3-triazole-5-carboxylate
Ethyl 1-ethoxycarbonylmethyl-piperidine-4-carboxylate 1838-39-7 C12H21NO4 243.30 PIPERIDINE-1,4-DICARBOXYLIC ACID DIETHYL ESTER; ethyl 4-(ethoxycarbonyl)piperidine-1-acetate; N-Ethyl aletate-4-Ethy Piperidinelarboxylate; 4-[Ethoxycarbonyl]-1-piperidineacetic acid ethyl ester
Ethyl 1-Cyclopropy1-6,7-Difluoro-8-Methyl-5-Nitro-4-oxo-1,4-Dihydroquinoline-3-Carboxylate 167888-36-0 C16H14F2N2O5 0 ethyl 1-cyclopropyl-6,7-difluoro-8-methyl-5-nitro4-oxo-1,4-dihydroquinoline-3-ca; Ethyl1-cyclopropyl-6,7-difluoro-8-methyl-5-nitro-4-oxo-1,4-dihydroquinoline-3-carboxylate
Ethyl 1-cyclohexyl-5-hydroxy-2-methyl-1H-indole-3-carboxylate 101782-20-1 C18H23NO3 301.38012;g/mol Ethyl1-cyclohexyl-5-hydroxy-2-methyl-1H-indole-3-carboxylate; 101782-20-1; CXEMQLWMAUFGHN-UHFFFAOYSA-N; ethyl1-cyclohexyl-5-hydroxy-2-methylindole-3-carboxylate; 1H-Indole-3-carboxylicacid,1-cyclohexyl-5-hydroxy-2-methyl-,ethylester; ACMC-20edcn
Ethyl 1-cyanocyclopentanecarboxylate 28247-14-5 C9H13NO2 167.20502;g/mol ethyl1-cyanocyclopentanecarboxylate;ethyl1-cyanocyclopentane-1-carboxylate;28247-14-5;SCHEMBL3523;AC1Q327U;CTK1A1287
ETHYL 1-BOC-PIPERAZINE-2-CARBOXYLATE HCL 741288-80-2 C12H23ClN2O4 0 ETHYL 1-BOC-PIPERAZINE-2-CARBOXYLATE HCL
Ethyl 1-Boc-4-isopropyl-4-piperidinecarboxylate 1022128-75-1 C16H29NO4
Ethyl 1-Boc-4-ethyl-4-piperidine carboxylate 188792-70-3 C15H27NO4 285.38
ETHYL 1-BENZYLPIPERIDINE-2-CARBOXYLATE 77034-34-5 C15H21NO2 247.33 ETHYL 1-BENZYLPIPERIDINE-2-CARBOXYLATE
Ethyl 1-benzyl-5-oxopyrrolidine-3-carboxylate 5733-87-9 C14H17NO3 247.29 Ethyl 1-benzyl-5-oxopyrrolidine-3-carboxylate; 5-Oxo-1-(phenylmethyl)-3-pyrrolidinecarboxylic acid ethyl ester
Ethyl 1-benzyl-4-trifluomethylpyrrolidine-3-carboxylate (mixture of cis- and trans-) 913744-78-2 C15H18F3NO2 0 Ethyl 1-benzyl-4-trifluomethylpyrrolidine-3-carboxylate (mixture of cis- and trans-); Ethyl 1-benzyl-4-trifluoromethylpyrrolidine-3-carboxylate
ETHYL 1-BENZYL-4-METHYLPIPERAZINE-2-CARBOXYLATE 63285-59-6 C15H22N2O2 262.34738 ETHYL 1-BENZYL-4-METHYLPIPERAZINE-2-CARBOXYLATE
Ethyl 1-benzyl-4-hydroxypiperidine-3-carboxylate 956010-25-6 C15H21NO3 263.15
ETHYL 1-BENZYL-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-52-3 C19H18N2O2 306.36 SALOR-INT L201405-1EA; ETHYL 1-BENZYL-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE
Ethyl 1-benzyl-1,2,3,6-tetrahydropyridine-4-carboxylate 23019-62-7 C15H19NO2 245.32 1-Benzyl-1,2,3,6-tetrahydroisonicotinic acid ethyl ester; Ethyl 1-benzyl-1,2,3,6-tetrahydropyridine-4-carboxylate; Ethyl 1-benzyl-1,2,3,6-tetrahydroisonicotinate
Ethyl 1-benzhydrylazetidine-3-carboxylate 887591-82-4 C19H21NO2 295.38
ETHYL 1-AZABICYCLO[2.2.1]HEPTANE-4-CARBOXYLATE 119102-24-8 C9H15NO2 169.22 ETHYL 1-AZABICYCLO[2.2.1]HEPTANE-4-CARBOXYLATE
Ethyl 1-aminocyclopentane-1-carboxylate 1664-35-3 C8H15NO2
Ethyl 1-amino-7-chloro-6-fluoro-1,4-dihydro-4-oxoquinoline-3-carboxylate 88569-30-6 C12H10ClFN2O3
Ethyl 1-acetyl-4-methyl-6-propylcyclohex-3-ene-1-carboxylate 83878-03-9 C15H24O3
Ethyl 1-acetyl-2,2,5,5-tetramethyl-3-pyrroline-3-carbonyloxyformate 1076200-09-3 C14H21NO5 283.32024 ETHYL 1-ACETYL-2,2,5,5-TETRAMETHYL-3-PYRROLINE-3-CARBONYLOXYFORMATE
ETHYL 1-ACETYL-1H-INDAZOLE-5-CARBOXYLATE 192944-50-6 C12H12N2O3 232.24 ETHYL 1-ACETYL-1H-INDAZOLE-5-CARBOXYLATE
ETHYL 15-BROMOPENTADECANOATE 101592-34-1 C17H33BrO2 349.35 ETHYL 15-BROMOPENTADECANOATE
ETHYL 10-METHYL-9-PHENANTHRENECARBOXYLATE 232611-22-2 C18H16O2 264.32 232611-22-2; ETHYL10-METHYL-9-PHENANTHRENECARBOXYLATE; ethyl10-methylphenanthrene-9-carboxylate; CTK4F1199; ZINC90463900; PL002824
ETHYL 1-[4-(TRIFLUOROMETHYL)PYRIMIDIN-2-YL]PIPERIDINE-4-CARBOXYLATE 215654-84-5 C13H16F3N3O2 303.28 BUTTPARK 31\08-78; ETHYL N-[4-(TRIFLUOROMETHYL)PYRIMID-2-YL]PIPERIDINE-4-CARBOXYLATE; ETHYL 1-[4-(TRIFLUOROMETHYL)PYRIMIDIN-2-YL]PIPERIDINE-4-CARBOXYLATE
ETHYL 1,6-DIMETHYL-4-PHENYL-2-THIOXO-1,2,3,4-TETRAHYDRO-5-PYRIMIDINECARBOXYLATE 108958-81-2 C15H18N2O2S 290.38 ETHYL 1,6-DIMETHYL-4-PHENYL-2-THIOXO-1,2,3,4-TETRAHYDRO-5-PYRIMIDINECARBOXYLATE; AURORA KA-3500
ETHYL 1,4-DIMETHYLPIPERIDINE-4-CARBOXYLATE 408306-81-0 C10H19NO2 185.26 ETHYL 1,4-DIMETHYLPIPERIDINE-4-CARBOXYLATE
Ethyl 1,4-dimethylpiperazine-2-carboxylate 90729-01-4 C9H18N2O2 186.25 ETHYL 1,4-DIMETHYLPIPERAZINE-2-CARBOXYLATE; BUTTPARK 47\04-32
Ethyl 1,4-dibenzylpiperazine-2-carboxylate 72351-59-8 C21H26N2O2 338.44 BUTTPARK 32\04-68; ETHYL 1,4-DIBENZYLPIPERAZINE-2-CARBOXYLATE; 1,4-dibenzylpiperazine-2-carboxylicacidethylester
ethyl 1,3-dimethyl-4-oxo-1H,4H,7H-pyrazolo[3,4-b]pyridine-5-carboxylate 52744-83-9 C11H13N3O3 235.2392
Ethyl 1-(Aminomethyl)cyclopropanecarboxylate 400840-94-0 C7H13NO2 143.18 ETHYL 1-(AMINOMETHYL)CYCLOPROPANECARBOXYLATE; 1-(AMINOMETHYL)-CYCLOPROPANECARBOXYLIC ACID ETHYL ESTER; RARECHEM AL BW 0431; Cyclopropanecarboxylic acid, 1-(aminomethyl)-, ethyl ester (9CI); 1-TERT-BUTYROZLYCARBONYL-3-(4,4,5,5-TETRAMETHYL-1,3,2-DIOXABOLONE
Ethyl 1-(6-methylpyrazin-2-yl)piperidine-4-carboxylate 886851-60-1 C13H19N3O2 249.30886 ETHYL 1-(6-METHYLPYRAZIN-2-YL)PIPERIDINE-4-CARBOXYLATE
Ethyl 1-(5-nitro-2-pyridinyl)-4-piperidine carboxylate 300804-00-6 279.3
Ethyl 1-(4-pyridinyl)piperidine-4-carboxylate 121912-29-6 C13H18N2O2 234.29 Ethyl 1-(4-pyridinyl)piperidine-4-carboxylate; 3,4,5,6-Tetrahydro-2H-[1,4']bipyridinyl-4-carboxylic acid ethyl ester
ETHYL 1-(4-METHOXYPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 187998-66-9 C14H16N2O3 260.29 BUTTPARK 154\50-88; ETHYL 1-(4-METHOXYPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE; SALOR-INT L317616-1EA; RARECHEM AL BI 1355
ETHYL 1-(4-METHOXYPHENYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE 218632-36-1 C14H16N2O3 260.29 BUTTPARK 85\18-77; ETHYL 1-(4-METHOXYPHENYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE; 1-(4-METHOXYPHENYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE; 1-(4-Methoxyphenyl)-3-methyl-1H-pyrazole-5-carboxylic acid ethyl ester
Ethyl 1-(4-fluorophenyl)cyclopropanecarboxylate 1261956-33-5 C12H13FO2 0 Ethyl 1-(4-fluorophenyl)cyclopropanecarboxylate
ETHYL 1-(4-FLUOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 288252-73-3 C13H13FN2O2 248.25 RARECHEM AL BI 1356; SALOR-INT L317543-1EA; ETHYL 1-(4-FLUOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE; BUTTPARK 147\18-44
ETHYL 1-(4-FLUOROBENZYL)-5-METHYL-1H-PYRAZOLE-3-CARBOXYLATE 618070-48-7 C14H15FN2O2 262.28 SALOR-INT L201359-1EA; ETHYL 1-(4-FLUOROBENZYL)-5-METHYL-1H-PYRAZOLE-3-CARBOXYLATE
ETHYL 1-(4-FLUOROBENZYL)-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-55-6 C19H17FN2O2 324.35 ETHYL 1-(4-FLUOROBENZYL)-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE; SALOR-INT L201448-1EA
ETHYL 1-(4-FLUOROBENZYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-38-5 C14H15FN2O2 262.28 ETHYL 1-(4-FLUOROBENZYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE; SALOR-INT L201235-1EA
ETHYL 1-(4-ETHOXYPHENYL)-4-HYDROXY-1H-PYRAZOLE-3-CARBOXYLATE 26502-58-9 C14H16N2O4 276.29 ETHYL 1-(4-ETHOXYPHENYL)-4-HYDROXY-1H-PYRAZOLE-3-CARBOXYLATE; IFLAB-BB F1174-1795; 1-(4-ETHOXY-PHENYL)-4-HYDROXY-1H-PYRAZOLE-3-CARBOXYLIC ACID ETHYL ESTER
Ethyl 1-(4-cyanopyrid-2-yl)piperidine-4-carboxylate 906352-67-8 C14H17N3O2 259.30368 ETHYL 1-(4-CYANOPYRID-2-YL)PIPERIDINE-4-CARBOXYLATE
ETHYL 1-(4-CHLOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 169548-94-1 C13H13ClN2O2 264.71 SALOR-INT L317527-1EA; ETHYL 1-(4-CHLOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(4-CHLOROPHENYL)-5-(TRIFLUOROMETHYL)-1H-PYRAZOLE-4-CARBOXYLATE 112055-36-4 C13H10ClF3N2O2 318.68 BUTTPARK 47\18-06; ETHYL 1-(4-CHLOROPHENYL)-5-(TRIFLUOROMETHYL)-1H-PYRAZOLE-4-CARBOXYLATE; ETHYL 2-(4-CHLOROPHENYL)-3-(TRIFLUOROMETHYL)-PYRAZOLE-4-CARBOXYLATE; 1-(4-CHLORO-PHENYL)-5-TRIFLUOROMETHYL-1H-PYRAZOLE-4-CARBOXYLIC ACID ETHYL ESTER; SALOR-INT L251
ETHYL 1-(4-CHLOROPHENYL)-4-HYDROXY-1H-PYRAZOLE-3-CARBOXYLATE 26502-56-7 C12H11ClN2O3 266.68 IFLAB-BB F1174-1793; ETHYL 1-(4-CHLOROPHENYL)-4-HYDROXY-1H-PYRAZOLE-3-CARBOXYLATE; 1-(4-CHLORO-PHENYL)-4-HYDROXY-1H-PYRAZOLE-3-CARBOXYLIC ACID ETHYL ESTER
ETHYL 1-(4-CHLOROBENZYL)-5-METHYLIMIDAZOLE-4-CARBOXYLATE 208753-36-0 C14H15ClN2O2 278.73 ethyl1-(4-chlorobenzyl)-5-methylimidazole-4-carboxylate; 208753-36-0; ethyl1-[(4-chlorophenyl)methyl]-5-methylimidazole-4-carboxylate; 175202-89-8; Maybridge1_004767; AC1MCUEY
ETHYL 1-(4-CHLOROBENZYL)-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-53-4 C19H17ClN2O2 340.8 SALOR-INT L201413-1EA; ETHYL 1-(4-CHLOROBENZYL)-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE
ETHYL 1-(4-CHLOROBENZYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE 245035-73-8 C14H15ClN2O2 278.73 SALOR-INT L201227-1EA; ETHYL 1-(4-CHLOROBENZYL)-3-METHYL-1H-PYRAZOLE-5-CARBOXYLATE
ETHYL 1-(4-BROMOPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 187998-45-4 C13H13BrN2O2 309.16 SALOR-INT L317551-1EA; ETHYL 1-(4-BROMOPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(4-AMINOPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 260046-88-6 C13H15N3O2 245.28 ETHYL 1-(4-AMINOPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(4-AMINOPHENYL)-3,5-DIMETHYL-1H-PYRAZOLE-4-CARBOXYLATE 257863-04-0 C14H17N3O2 259.3 ETHYL 1-(4-AMINOPHENYL)-3,5-DIMETHYL-1H-PYRAZOLE-4-CARBOXYLATE
Ethyl 1-(4,6-dichloro-1,3,5-triazin-2-yl)piperidine-4-carboxylate 216502-45-3 C11H14Cl2N4O2 305.16 ETHYL 1-(4,6-DICHLORO-1,3,5-TRIAZIN-2-YL)PIPERIDINE-4-CARBOXYLATE
ETHYL 1-(4,4,4-TRIFLUORO-3-HYDROXYBUTYL)PIPERIDINE-4-CARBOXYLATE 215657-77-5 C12H20F3NO3 283.29 ethyl1-(4,4,4-trifluoro-3-hydroxybutyl)piperidine-4-carboxylate; 215657-77-5; AC1MCVGR; CTK4E7156; PC31114; HE325435
ETHYL 1-(3-PYRIDYLMETHYL)PIPERIDINE-4-CARBOXYLATE 138030-50-9 C14H20N2O2 248.32 ETHYL 1-(3-PICOLYL)PIPERIDINE-4-CARBOXYLATE; ETHYL 1-(3-PYRIDYLMETHYL)PIPERIDINE-4-CARBOXYLATE
ethyl 1-(3-oxobutyl)-4-phenylpiperidin-1-ium-4-carboxylate chloride 16036-86-5 C18H26ClNO3 339.857 g/mol
ETHYL 1-(3-CHLOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 618092-34-5 C13H13ClN2O2 264.71 SALOR-INT L317578-1EA; ETHYL 1-(3-CHLOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(3-CHLOROPHENYL)-5-(TRIFLUOROMETHYL)-1H-PYRAZOLE-4-CARBOXYLATE 112055-35-3 C13H10ClF3N2O2 318.68 SALOR-INT L251348-1EA; ETHYL 1-(3-CHLOROPHENYL)-5-(TRIFLUOROMETHYL)-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(3-AMINOBENZYL)PIPERIDINE-4-CARBOXYLATE 306937-22-4 C15H22N2O2 262.35 BUTTPARK 92\04-91; ETHYL 1-(3-AMINOBENZYL)PIPERIDINE-4-CARBOXYLATE
Ethyl 1-(3,4-dichlorophenyl)-5-methylpyrazole-4-carboxylate 175135-70-3
Ethyl 1-(3,4-dichlorophenyl)-5-methyl-1H-pyrazole-4-carboxylate 208944-53-0 C13H12Cl2N2O2 299.15 ETHYL 1-(3,4-DICHLOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(2-METHOXYPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 241798-35-6 C14H16N2O3 260.29 SALOR-INT L317594-1EA; ETHYL 1-(2-METHOXYPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
ETHYL 1-(2-FLUOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE 618092-38-9 C13H13FN2O2 248.25 SALOR-INT L317608-1EA; ETHYL 1-(2-FLUOROPHENYL)-5-METHYL-1H-PYRAZOLE-4-CARBOXYLATE
Ethyl 1-(2-Chloroacetyl)piperidine-4-Carboxylate 318280-71-6 C10H16NO3Cl 233.69 ETHYL 1-(2-CHLOROACETYL)-4-PIPERIDINECARBOXYLATE; Ethyl 1-(2-chloroacetyl)piperidine-4-carboxylate; 4-Piperidinecarboxylic acid, 1-(chloroacetyl)-, ethyl ester (9CI); Ethyl 1-(2-Chloroacetyl)-4-piperidinecarboxylate ,97%
ETHYL 1-(2,5-DICHLOROBENZYL)-5-METHYL-1H-PYRAZOLE-3-CARBOXYLATE 618070-47-6 C14H14Cl2N2O2 313.18 ETHYL 1-(2,5-DICHLOROBENZYL)-5-METHYL-1H-PYRAZOLE-3-CARBOXYLATE; SALOR-INT L201340-1EA
ETHYL 1-(2,5-DICHLOROBENZYL)-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE 618070-54-5 C19H16Cl2N2O2 375.25 SALOR-INT L201421-1EA; ETHYL 1-(2,5-DICHLOROBENZYL)-3-PHENYL-1H-PYRAZOLE-5-CARBOXYLATE
ETHYL 1-(2,4-DIFLUOROPHENYL)-5-METHYLPYRAZOLE-4-CARBOXYLATE 175135-71-4 C13H12F2N2O2 266.24 ETHYL 1-(2,4-DIFLUOROPHENYL)-5-METHYLPYRAZOLE-4-CARBOXYLATE; BUTTPARK 154\18-44; Ethyl 1-(2,4-difluorophenyl)-5-methylpyrazole-4-carboxylate 95%; Ethyl1-(2,4-difluorophenyl)-5-methylpyrazole-4-carboxylate95%; ethyl 1-(2,4-difluorophenyl)-5-methyl-1H-pyraz
Ethyl 1-((pyridin-4-yl)methyl)piperidine-4-carboxylate 138030-54-3 C14H20N2O2 248.32 ethyl 1-((pyridin-4-yl)methyl) piperidine-4-carboxylate; 1-(4-Pyridinylmethyl)-4-piperidinecarboxylic acid ethyl ester
Ethyl {[2-nitro-4-(trifluoromethyl)phenyl]amino}acetate 735-40-0 C11H11F3N2O4 0 Ethyl {[2-nitro-4-(trifluoromethyl)phenyl]amino}acetate; Ethyl 2-(2-nitro-4-trifluoromethylphenylamino)acetate
Ethyl [3,5-bis(trifluoromethyl)phenyl](oxo)acetate 402568-10-9 C12H8F6O3 314.18 ETHYL 2-[3,5-BIS(TRIFLUOROMETHYL)PHENYL]-2-OXOACETATE; ETHYL 2-[3,5-BIS(TRIFLUOROMETHYL)PHENYL]GLYOXYLATE; Ethyl 3,5-bis(trifluoromethyl)phenyl-2-oxoacetate, tech; Ethyl [3,5-Bis(trifluoromethyl)phenyl](oxo)acetate
ETHYL [2-METHYL-3-(CHLOROSULFONYL)PHENOXY]ACETATE 91427-62-2 C11H13ClO5S 292.74 ETHYL [2-METHYL-3-(CHLOROSULFONYL)PHENOXY]ACETATE
Ethyl [2-diethylaminocarbonylthio)]phenylacetate 1076198-03-2 C15H21NO3S 295.4 ETHYL [2-DIETHYLAMINOCARBONYLTHIO)]PHENYLACETATE
ethyl [1,2,4]triazolo[1,5-a]pyridine-2-carboxylate 62135-58-4 C9H9N3O2 191.18700
Ethyl [(chloroacetyl)(phenyl)amino]acetate 51114-26-2 C12H14ClNO3 255.69746;g/mol 51114-26-2;ethyl[(chloroacetyl)(phenyl)amino]acetate;SGQRYQFBLARGLN-UHFFFAOYSA-N;ethyl2-(2-chloro-N-phenylacetamido)acetate;Glycine,N-(chloroacetyl)-N-phenyl-,ethylester(9CI);ZINC02522977
Ethyl (Z)hex-3-enoate 64187-83-3 C8H14O2
ethyl (Z)-2-acetylhex-2-enoate 31336-34-2 C10H16O3 0 ethyl (Z)-2-acetylhex-2-enoate; 2-Hexenoic acid, 2-acetyl-, ethyl ester
ETHYL (TETRAHYDRO-FURAN-2-CARBONYL)-AMINO-ACETATE 574719-90-7 0 ETHYL (TETRAHYDRO-FURAN-2-CARBONYL)-AMINO-ACETATE
Ethyl (S)-nipecotate L-tartarate 83602-38-4
Ethyl (S)-nipecotate (D)-tartlate 60218-50-0 0 Ethyl (S)-nipecotate (D)-tartlate
Ethyl (S)-4-Cyano-3-Hydroxybutyrate 312745-91-8 C7H11NO3 157.17 (S)-ETHYL-4-CYANO-3-HYDROXYBUTYRATE; (S)-4-CYANO-3-HYDROXYBUTANOATE ETHYL; BUTANOIC ACID 4-CYANO-3-HYDROXY-ETHYL ESTER, (S); ETHYL (S)-(+)-4-CYANO-3-HYDROXYBUTYRATE; ETHYL(S)-4-CYANO-3-HYDROXY-BUTYRATE; ETHYL (S)-4-CYANO-3-HYDROXYBUTANOATE; (3S)-4-Cyano-3
ETHYL (S)-3-HYDROXYHEXANOATE 88496-71-3 C8H16O3 160.21084 ETHYL (S)-3-HYDROXYHEXANOATE
ETHYL (S)-2-HYDROXY-2-METHYLBENZENEPROPANOATE 285130-47-4 C12H16O3 208.25 ETHYL (S)-2-HYDROXY-2-METHYLBENZENEPROPANOATE; (S)-2-Hydroxy-2-methyl-3-phenylpropionic acid ethyl ester
Ethyl (S)-2-amino-4-phenylbutyrate 46460-23-5 C12H17NO2 207.27 Homophenyl-L-alanine ethyl ester; Ethyl (S)-2-amino-4-phenylbutyrate
ETHYL (S)-2-AMINO-2-ETHYLHEXANOATE 164262-42-4 C10H21NO2 187.28 ETHYL (S)-2-AMINO-2-ETHYLHEXANOATE; (S)-2-Amino-2-ethylhexanoic acid ethyl ester
Ethyl (R)-4-benzyloxy-3-hydroxybutyrate 106058-91-7 C13H18O4 238.28
ETHYL (R)-2-HYDROXY-2-METHYLBENZENEPROPANOATE 205505-45-9 C12H16O3 208.25 ETHYL (R)-2-HYDROXY-2-METHYLBENZENEPROPANOATE; (R)-2-Hydroxy-2-methyl-3-phenylpropionic acid ethyl ester
ETHYL (R)-2-AMINO-2-METHYLBUTYRATE 40916-97-0 C7H15NO2 145.2 ETHYL (R)-2-AMINO-2-METHYLBUTYRATE
ETHYL (R)-(-)-2-METHOXYPROPIONATE 40105-20-2 C6H12O3 132.16
Ethyl (p-tosyloxy)acetate 39794-75-7 C11H14O5S 0 Acetic acid, [[(4-methylphenyl)-sulfonyl]oxy]-, ethyl ester; Ethyl (p-tosyloxy)acetate; Tosylethylglycolate; Ethyl 2-(p-Toluenesulfonyloxy)acetate
Ethyl (ethoxymethylene)cyanoacetate,98% 34-45-7 C8H11NO3 169.17784
Ethyl 6-Methyl-3-oxo-2,3-dihydropyridazine-4-carboxylate 2125-90-8 C8H10N2O3 0 Ethyl 6-Methyl-3-oxo-2,3-dihydropyridazine-4-carboxylate
Ethyl 6-Hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate 134388-85-5 C12H15NO3 0 Ethyl 6-Hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate
Ethyl 23980-14-5 0 Ethyl 7-chloro-5-(o-chlorophenyl)-2,3-dihydro-2-oxo-1H-1,4-benzodiazep ine-3-carboxylate.; 7-Chloro-5-(o-chlorophenyl)-2,3-dihydro-2-oxo-1H-1,4-benzodiazepine-3-carboxylic acid ethyl ester; CM-7101
Ethtylenediamine Tetraacetic Acid, Monosodium Ferr 15708-42-6 C10H16FeN2NaO10 403.08 (ETHYLENEDINITRILO)TETRAACETIC ACID FERRIC SODIUM SALT DIHYDRATE; ETHYLENEDIAMINETETRAACETIC ACID FERRIC SODIUM SALT DIHYDRATE; Ethtylenediamine tetraacetic acid, monosodium ferric salt; EDTA.NaFe; Ferrate(1-), N,N-1,2-ethanediylbisN-(carboxy-.kappa.O)met
Ethoxytrichlorosilane 1825-82-7 183.48
Ethoxysulfuron 126801-58-9 C15H18N4O7S 398.39 ETHOXYSULFURON; 1-(4,6-dimethoxypyrimidin-2-yl)-3-(2-ethoxyphenoxysulfonyl)urea; 1(4,6-dimethoxypyrimidin-2-yl)-3-(2-ethoxyphenoxysulfony)urea; 2-ethoxyphenyl ester (((4,6-dimethoxypyrimidin-2-yl)amino)carbonyl)sulfamic acid; Sunrice; ETHOXYSULFURON PESTA
Ethoxylated trimethylolpropane triacrylate 28961-43-5 (C2H4 O)n (C2 H4 O)n (C2 H4 O)n C15 H20 O6 0 2,2',2''-(propylidynetris(methyleneoxy))tri-ethanotriacrylate; 2-ethanediyl),alpha-hydro-omega-[(1-oxo-2-propenyl)oxy]-poly(oxy-etherw; ith2-ethyl-2-(hydroxymethyl)-1,3-propanediol(3:1); Poly(oxy-1,2-ethanediyl),.alpha.-hydro-.omega.-[(1-oxo-2-propenyl)ox
ETHOXYLATED TETRABROMO BISPHENOL ''A'' DIACRYLATE 66710-97-2 C25H24Br4O6 740.07046 ETHOXYLATED TETRABROMO BISPHENOL A DIACRYLATE; ETHOXYLATED TETRABROMO BISPHENOL ''A'' DIACRYLATE; 2-propenoicacid,(1-methylethylidene)bis[(2,6-dibromo-4,1-phenylene)oxy-2,1-et; (1-methylethylidene)bis[(2,6-dibromo-4,1-phenylene)oxy-2,1-ethanediyl] diacryl
Ethoxylated propoxylated 2,4,7,9-tetramethyl-5-decyne-4,7-diol 182211-02-5
Ethoxylated linear C12-15-sec-alcohol sulfate 68511-39-7
Ethoxylated di-sec-butylphenol 53964-94-6
Ethoxylated (C10-C12) alcohols, maleic anhydride, sodium sulfite reaction product 68954-91-6
Ethoxylated (2) bisphenol A dimethacrylate 41637-38-1 (C2H4O)n(C2H4O)nC23H24O4 0
Ethoxylated (2) bisphenol A diacrylate 64401-02-1
Ethoxyethoxyethyl acrylate 7328-17-8 C9H16O4 188.22 2-(2-ethoxyethoxy)ethyl2-propenoate; 2-Propenoicacid,2-(2-ethoxyethoxy)ethylester; ethylcarbitolacrylate; lightacrylateec-a; lightestereca; r672; rc20; reactomerrc20
ETHOXY-ETHOXYCARBONYL-METHYLTRIPHENYLPHOSPHONIUM CHLORIDE 16847-90-8 C24H26ClO3P 428.89 ETHOXY-ETHOXYCARBONYL-METHYLTRIPHENYLPHOSPHONIUM CHLORIDE; Ethoxy-ethoxycarbonyl-methyltriphenylphosphonium chloride, 98 %
ETHOXYCARBONYLMETHYL ETHYL METHYLENEMALONATE 116280-23-0 C10H14O6 230.21456 ETHOXYCARBONYLMETHYL ETHYL METHYLENEMALONATE
Ethoxybenzamide 27043-22-7 C9H11NO2 165.19 ar-ethoxybenzamide; Ethoxybenzamide
Ethoxyacetic anhydride 14521-87-0 C8H14O5 190.19376 ethoxyacetic anhydride; Bis(ethoxyacetic)anhydride
ethoxy(ethyl)phosphinic acid 53396-55-7 C4H11O3P 138.102 g/mol
ETHOXY PROPANOL 52125-53-8 C5H12O2 104.15 Propanol, 1(or 2)-ethoxy-; PROPYLENEGLYCOL3-ETHYLETHER; 1-ethoxy-Propanol; ethyl ether of propylene glycol; 1(OR 2)-ETHOXYPROPANOL; 1,2-Propanediol, monoethyl ether
Ethanone,2-chloro-1-[1-(2,5-difluorophenyl)-2,5-dimethyl-1H-pyrrol-3-yl]- 885268-70-2 C14H12 Cl F2 N O 283.70100
Ethanone,2-chloro-1-[1-(2,5-dichlorophenyl)-2,5-dimethyl-1H-pyrrol-3-yl]- 885268-72-4 C14H12 Cl3 N O 316.61000
Ethanone,2-chloro-1-(5-methyl-2-thienyl)- 31772-42-6 C7H7 Cl O S 174.64788 31772-42-6; 2-chloro-1-(5-methylthien-2-yl)ethanone; 2-chloro-1-(5-methylthiophen-2-yl)ethanone; 2-Chloro-1-(5-methyl-thiophen-2-yl)-ethanone; Ethanone,2-chloro-1-(5-methyl-2-thienyl)-; ZINC04206206
Ethanone,2-chloro-1-(3,4-dihydro-4-phenyl-1,5-benzothiazepin-5(2H)-yl)- 20044-86-4 C17H16 Cl N O S 246.01496;g/mol 5-Bromo-2-hydroxy-3-nitrobenzaldehyde;5-Bromo-3-nitrosalicylaldehyde;16634-88-1;YEYPSUQQZNDKDE-UHFFFAOYSA-N;Benzaldehyde,5-bromo-2-hydroxy-3-nitro-;Benzaldehyde,5-bromo-2-hydroxy-3-nitro-
Ethanone,2-bromo-1-[3-(3,4-dichlorophenyl)-5-isoxazolyl]- 175277-38-0 C11H6 Br Cl2 N O2 334.98 TIMTEC-BB SBB005591; 5-(BROMOACETYL)-3-(3,4-DICHLOROPHENYL)ISOXAZOLE; 2-BROMO-1-[3-(3,4-DICHLOROPHENYL)ISOXAZOL-5-YL]ETHAN-1-ONE; BUTTPARK 43\57-73; 5-(Bromoacetyl)-3-(3,4-dichlorophenyl)isoxazoletech; 2-Bromo-1-[3-(3,4-dichlorophenyl)isoxazol-5-yl]ethan-
Ethanone,2-bromo-1-(3,5-dihydroxyphenyl)- 62932-92-7 C8H7 Br O3 231.04 3,5-DIHYDROXY-ALFA-BROMOACETOPHENONE; 3,5-DIHYDROXY-ALPHA-BROMOACETOPHENONE; 2-BROMO-1-(3,5-DIHYDROXYPHENYL)ETHANONE; 3',5'-Dihydroxyphenacyl bromide
Ethanone,2-bromo-1-(1,5-dimethyl-1H-imidazol-4-yl)- 223785-74-8 C7H9BrN2O 217.06316 2-bromo-1-(1,5-dimethylimidazol-4-yl)ethanone; 223785-74-8; 2-BROMO-1-(1,5-DIMETHYL-1H-IMIDAZOL-4-YL)-ETHANONE; ETHANONE,2-BROMO-1-(1,5-DIMETHYL-1H-IMIDAZOL-4-YL)-; SCHEMBL5725062; ZINC39055678
Ethanone,2-[(2-methyl-9-acridinyl)thio]-1-phenyl- 134826-36-1 C22H17 N O S 343.44148;g/mol 134826-36-1; BRN4879334; Ethanone,2-[(2-methyl-9-acridinyl)thio]-1-phenyl-; 2-((2-Methyl-9-acridinyl)thio)-1-phenylethanone; Ethanone,2-((2-methyl-9-acridinyl)thio)-1-phenyl-; AC1MIQD1
Ethanone,2,2-dihydroxy-1-[4-(1-piperidinyl)phenyl]- 93290-93-8 C13H17 N O3 235.28 4-PIPERIDINYLPHENYLGLYOXAL HYDRATE; 4-(Piperidin-1-ylphenyl)glyoxal hydrate; 4-(Piperidin-1-ylphenyl)glyoxal hydrate 95%; 4-PIPERIDINYLPHENYLGLYOXAL HYDRATE, 95+%; Zinc04204393
Ethanone,2,2,2-trifluoro-1-[4-(phenylmethyl)-1-piperazinyl]- 2803-00-1 C13H15 F3 N2 O 272.26621;g/mol 1-(4-benzylpiperazin-1-yl)-2,2,2-trifluoroethanone;ETHANONE,2,2,2-TRIFLUORO-1-[4-(PHENYLMETHYL)-1-PIPERAZINYL]-;2803-00-1;N-benzylpiperazine,TFA;AC1NQ69K;MolPort-006-758-138
Ethanone,2,2',2''-silylidynetris[1-[3-(trifluoromethyl)phenyl]- 6947-93-9 C27H19 F9 O3 Si 589.5011
Ethanone,2,2'-(1,4-piperazinediyl)bis[1-(4-chlorophenyl)- 5447-51-8 C20H20 Cl2 N2 O2 391.291;g/mol MLS002638451;5447-51-8;2,2'-piperazine-1,4-diylbis[1-(4-chlorophenyl)ethanone];Ethanone,2,2'-(1,4-piperazinediyl)bis[1-(4-chlorophenyl)-;1-(4-CHLOROPHENYL)-2-[4-[2-(4-CHLOROPHENYL)-2-OXO-ETHYL]PIPERAZIN-1-YL]ETHANONE;1-(4-chlorophenyl)-2-[4-[2-(4-chloroph
Ethanone,2-(2-methylpropoxy)-1,2-diphenyl- 22499-12-3 C18H20 O2 268.3502 2-(2-methylpropoxy)-1,2-diphenyl-ethanon; 2-(2-methylpropoxy)-1,2-diphenyl-Ethanone; 5-Methyl-3-oxa-1,2-diphenyl-1-hexanone; Acetophenone, 2-isobutoxy-2-phenyl-; Isobutyl benzoin ether; Triganol; Vicure 10; BENZOIN ISOBUTYL ETHER
Ethanone,2-(2-imino-3-thiazolidinyl)-1-phenyl-, hydrochloride (1:1) 83846-65-5 C11H12 N2 O S . Cl H 256.75172
Ethanone,1-[3-amino-5-(4-chlorophenyl)-2-thienyl]- 175137-02-7 C12H10 Cl N O S 251.73 1-[3-AMINO-5-(4-CHLOROPHENYL)-2-THIENYL]ETHAN-1-ONE; 2-ACETYL-3-AMINO-5-(4-CHLOROPHENYL)THIOPHENE
Ethanone,1-[2-amino-4-methoxy-5-(phenylmethoxy)phenyl]- 516526-41-3 C16H17NO3 271.31108;g/mol 1-(2-amino-4-methoxy-5-phenylmethoxyphenyl)ethanone;516526-41-3;1-(2-amino-5-(benzyloxy)-4-methoxyphenyl)ethanone;Ethanone,1-[2-amino-4-methoxy-5-(phenylmethoxy)phenyl]-;1-[2-Amino-5-(benzyloxy)-4-methoxyphenyl]ethanone;1-[2-amino-4-methoxy-5-(phenylmetho
Ethanone,1-[2-[3-[3-[2-(7-chloro-2-quinolinyl)ethenyl]phenyl]-3-hydroxypropyl]phenyl]-,(S)- (9CI) 144551-23-5 C28H24 Cl N O2 441.94866;g/mol 1-[2-[(3S)-3-[3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl]-3-hydroxypropyl]phenyl]ethanone;184764-13-4;1-{2-[(3S)-3-{3-[(E)-2-(7-Chloro-2-quinolinyl)vinyl]phenyl}-3-hydroxypropyl]phenyl}ethanone;144551-23-5;SCHEMBL626096;1-[2-[(3S)-3-[3-[(1E)-2-(7-Chlo
Ethanone,1-[2,6-bis(phenylmethoxy)phenyl]- 3886-19-9 C22H20 O3 332.3924
Ethanone,1-[2,4-dihydroxy-5-(1-methylethyl)phenyl]- 747414-17-1 C11H14 O3 194.22700
Ethanone,1-[2-(acetyloxy)phenyl]- 7250-94-4 C10H10 O3 178.1846 2'-ACETOXYACETOPHENONE; 2-ACETOXYACETOPHENONE; 2-ACETYLPHENYL ACETATE; 2-Acetoxyacetophenone,99%; 1-(2-acetoxyphenyl)ethanone; 2-Acetoxyacetophenone,98%
Ethanone,1-[2-(2-thienyl)cyclopropyl]- 478262-59-8 C9H10OS 166.2401 Ethanone,1-[2-(2-thienyl)cyclopropyl]-; Ethanone, 1-[2-(2-thienyl)cyclopropyl]- (9CI)
Ethanone,1-[1,1'-biphenyl]-4-yl-2,2-dihydroxy- 1145-04-6 C14H12 O3 228.24 4-BIPHENYLGLYOXAL HYDRATE; 1-((1,1'-biphenyl)-4-yl)-2,2-dihydroxyethanone; 2,2-dihydroxy-4'-phenyl-acetophenon; 2,2-dihydroxy-4'-phenylacetophenone; 4-diphenylglyoxalmonohydrate; Biphenyl-4-glyoxal hydrate; Biphenyl-4-glyoxal hydrate 95%; 4-BIPHENYLGLYOXA
Ethanone,1-[(3R,4S)-4-amino-3,4-dihydro-3-hydroxy-2,2-dimethyl-2H-1-benzopyran-6-yl]- 175133-79-6 C13H17 N O3 235.27898;g/mol 1-[(3R,4S)-4-amino-3-hydroxy-2,2-dimethyl-3,4-dihydrochromen-6-yl]ethanone;175133-79-6;1-((3R,4S)-4-AMINO-3-HYDROXY-2,2-DIMETHYLCHROMAN-6-YL)ETHANONE;SCHEMBL7049232;AECGYOKFJFSDKI-NWDGAFQWSA-N;MolPort-005-943-232
Ethanone,1-[(3E)-3-(chloromethylene)-2,3-dihydro-1-benzoxepin-7-yl]- 190143-31-8 C13H11 Cl O2
Ethanone,1-[(2S)-1-amino-2-pyrrolidinyl]- 515837-17-9 C6H12N2O 128.17228 Ethanone,1-[(2S)-1-amino-2-pyrrolidinyl]-; Ethanone, 1-[(2S)-1-amino-2-pyrrolidinyl]- (9CI)
Ethanone,1-(6-methyl-4-pyrimidinyl)- 67073-96-5 C7H8N2O 136.15122 Ethanone,1-(6-methyl-4-pyrimidinyl)-; Ethanone, 1-(6-methyl-4-pyrimidinyl)- (9CI); 1-(6-Methyl-4-pyrimidinyl)-ethanone
Ethanone,1-(6-fluoro-2-pyridinyl)- 501009-05-8 C7H6FNO 139.1270432 Ethanone,1-(6-fluoro-2-pyridinyl)-; Ethanone, 1-(6-fluoro-2-pyridinyl)- (9CI)
Ethanone,1-(6-ethynyl-3,4-dihydro-2H-pyran-2-yl)- 178742-85-3 C9H10O2 150.1745 Ethanone,1-(6-ethynyl-3,4-dihydro-2H-pyran-2-yl)-; Ethanone, 1-(6-ethynyl-3,4-dihydro-2H-pyran-2-yl)- (9CI)
Ethanone,1-(6-amino-1H-indazol-1-yl)- 501653-37-8 C9H9 N3 O 175.18726;g/mol 501653-37-8;1-(6-aminoindazol-1-yl)ethanone;Ethanone,1-(6-amino-1H-indazol-1-yl)-;1-(6-AMINO-1H-INDAZOL-1-YL)ETHANONE;AC1L8IZB;SCHEMBL15069177
Ethanone,1-(5-fluorobenzo[b]thien-3-yl)- 187658-19-1 C10H7 F O S
Ethanone,1-(5-ethynyl-4,5-dihydro-2-methyl-3-furanyl)- 75822-59-2 C9H10O2 150.1745 Ethanone,1-(5-ethynyl-4,5-dihydro-2-methyl-3-furanyl)-; Ethanone, 1-(5-ethynyl-4,5-dihydro-2-methyl-3-furanyl)- (9CI)
Ethanone,1-(5-ethynyl-2-thienyl)- 658701-97-4 C8H6OS 150.19764 Ethanone,1-(5-ethynyl-2-thienyl)-; Ethanone, 1-(5-ethynyl-2-thienyl)- (9CI)
Ethanone,1-(5-ethyl-2-pyridinyl)- 286411-85-6 C9H11NO 149.18974 Ethanone,1-(5-ethyl-2-pyridinyl)-; Ethanone, 1-(5-ethyl-2-pyridinyl)- (9CI)
Ethanone,1-(5-ethenyl-2-pyridinyl)- 633335-93-0 C9H9NO 147.17386 Ethanone,1-(5-ethenyl-2-pyridinyl)-; Ethanone, 1-(5-ethenyl-2-pyridinyl)- (9CI)
Ethanone,1-(5-bromobenzo[b]thien-3-yl)- 1423-63-8 C10H7 Br O S 255.13 1-(5-BROMO-1-BENZOTHIEN-3-YL)ETHANONE; 1-(5-BROMOBENZO[B]THIOPHEN-3-YL)ETHAN-1-ONE; 3-ACETYL-5-BROMO-BENZO[B]THIOPHENE; 1-(5-Bromo-1-benzothien-3-yl)ethanone ,97%
Ethanone,1-(5-amino-1H-1,2,3-triazol-4-yl)- 205942-79-6 C4H6N4O 126.11664 Ethanone,1-(5-amino-1H-1,2,3-triazol-4-yl)-; Ethanone, 1-(5-amino-1H-1,2,3-triazol-4-yl)- (9CI)
Ethanone,1-(4-nitro-5-isoxazolyl)- 518994-53-1 C5H4N2O4 156.09626 Ethanone,1-(4-nitro-5-isoxazolyl)-; Ethanone, 1-(4-nitro-5-isoxazolyl)- (9CI)
Ethanone,1-(4-nitro-3-isoxazolyl)- 550301-44-5 C5H4N2O4 156.09626 Ethanone,1-(4-nitro-3-isoxazolyl)-; Ethanone, 1-(4-nitro-3-isoxazolyl)- (9CI)
Ethanone,1-(4-methyl-5-pyrimidinyl)- 87379-42-8 C7H8N2O 136.15122 Ethanone,1-(4-methyl-5-pyrimidinyl)-; Ethanone, 1-(4-methyl-5-pyrimidinyl)- (9CI)
Ethanone,1-(4-methoxyphenyl)-2-[(3-methoxyphenyl)thio]- 63675-73-0 C16H16 O3 S 288.36 4-METHOXY-ALPHA-[(3-METHOXYPHENYL)THIO]ACETOPHENONE; 4-METHOXY-A-((3-METHOXY PHENYL)THIO)ACETOPHENONE; 4-METHOXY-[(3-METHOXYPHENYL)THIO]ACETOPHENONE; 4-Methoxy-A-[(3-Methoxyphenyl)Thiol]Acetophenone; 1-(4-METHOXYPHENYL)-2-(3-MEETHOXYPHENYLTHIO)ETHANONE; 2
Ethanone,1-(4-methoxyphenyl)-2,2-bis[(4-nitrophenyl)amino]- 94872-51-2 C21H18 N4 O6 422.39100
Ethanone,1-(4-methoxyphenyl)-2-(methylsulfonyl)- 27918-36-1 C10H12 O4 S 228.26488 1-(4-Methoxyphenyl)-2-(methylsulphonyl)-1-ethanone
Ethanone,1-(4-ethynylcyclohexyl)- 503175-43-7 C10H14O 150.21756 Ethanone,1-(4-ethynylcyclohexyl)-; Ethanone, 1-(4-ethynylcyclohexyl)- (9CI)
Ethanone,1-(4-ethynyl-3-cyclohexen-1-yl)- 178742-84-2 C10H12O 148.20168 Ethanone,1-(4-ethynyl-3-cyclohexen-1-yl)-; Ethanone, 1-(4-ethynyl-3-cyclohexen-1-yl)- (9CI)
Ethanone,1-(4-ethyl-5-methoxy-2-nitrophenyl)- 947691-66-9 C11H13 N O4 223.22500
Ethanone,1-(4-ethyl-3-pyridinyl)- 435273-43-1 C9H11NO 149.18974 Ethanone,1-(4-ethyl-3-pyridinyl)-; Ethanone, 1-(4-ethyl-3-pyridinyl)- (9CI)
Ethanone,1-(4-ethyl-3-hydroxyphenyl)- 73898-20-1 C10H12 O2
Ethanone,1-(4-decylphenyl)-2,2,2-trifluoro- 100444-41-5 C18H25 F3 O 314.39 4'-DECYL-2,2,2,2-TRIFLUOROACETOPHENONE; 4'-(DECYL)-2,2,2-TRIFLUOROACETOPHENONE; 4-DECYL-ALPHA,ALPHA,ALPHA-TRIFLUOROACETOPHENONE; P-DECYL-A,A,A-TRIFLUOROACETOPHENONE; P-DECYL-ALPHA,ALPHA,ALPHA-TRIFLUOROACETOPHENONE; 1-(4-Decylphenyl)-2,2,2-trifluoroethanon
Ethanone,1-(4-chlorophenyl)-, 2-[1-(4-chlorophenyl)ethylidene]hydrazone 5326-15-8 C16H14 Cl2 N2 305.2018
Ethanone,1-(4-chloro-3-hydroxyphenyl)- 61124-56-9 C8H7 Cl O2 170.59300
Ethanone,1-(4-chloro-2-methylphenyl)- 37074-38-7 C9H9 Cl O 168.62 4-CHLORO-2-METHYLACETOPHENONE
Ethanone,1-(4-chloro-1H-indazol-1-yl)- 145439-15-2 C9H7 Cl N2 O 0 1-(4-Chloro-1H-indazol-1-yl)ethanone; 1-Acetyl-4-chloro-1H-indazole; 1-(4-Chloro-1H-indazol-1-yl)ethan-1-one
Ethanone,1-(4-amino-6-methyl-3-pyridinyl)- 127915-47-3 C8H10N2O 150.1778 Ethanone,1-(4-amino-6-methyl-3-pyridinyl)-; Ethanone, 1-(4-amino-6-methyl-3-pyridinyl)- (9CI)
Ethanone,1-(4'-amino[1,1'-biphenyl]-4-yl)- 1141-39-5 C14H13 N O
Ethanone,1-(4,6-dimethyl-2-pyrimidinyl)- 64571-50-2 C8H10N2O 150.1778 Ethanone,1-(4,6-dimethyl-2-pyrimidinyl)-; Ethanone, 1-(4,6-dimethyl-2-pyrimidinyl)- (9CI)
Ethanone,1-(3-phenyl-5-isoxazolyl)- 2048-69-3 C11H9 N O2 187.19 5-ACETYL-3-PHENYLISOXAZOLE; 3-PHENYL-5-ACETYL ISOXAZOLE; 1-(3-PHENYL-5-ISOXAZOLYL)-1-ETHANONE; 1-(3-PHENYLISOXAZOL-5YL)ETHANONE; BUTTPARK 75\12-45; 1-(3-phenylisoxazol-5-yl)ethan-1-one
Ethanone,1-(3-iodo-4-methylphenyl)- 52107-84-3 C9H9 I O 260.07 3'-IODO-4'-METHYLACETOPHENONE; ETHANONE, 1-(3-IODO-4-METHYLPHENYL)-
Ethanone,1-(3-chloro-4-pyridinyl)- 78790-82-6 C7H6 Cl N O 155.58200
Ethanone,1-(3,5-dimethyl-2-pyridinyl)- 110788-51-7 C9H11NO 149.18974 Ethanone,1-(3,5-dimethyl-2-pyridinyl)-; Ethanone, 1-(3,5-dimethyl-2-pyridinyl)- (9CI)
Ethanone,1-(3,5-dimethyl-1H-pyrrol-2-yl)- 1500-93-2 C8H11 N O 137.18 1-(3,5-DIMETHYL-1H-PYRROL-2-YL)ETHAN-1-ONE; Ethanone, 1-(3,5-dimethyl-1H-pyrrol-2-yl)- (9CI); 1-(3,5-Dimethyl-1h-pyrrol-2-yl)ethan-1-one, tech
Ethanone,1-(3,4-dihydro-6-methyl-2H-pyran-2-yl)- 28450-02-4 C8H12 O2 140.17968;g/mol 1-(6-methyl-3,4-dihydro-2H-pyran-2-yl)ethanone;2-Acetyl-6-methyl-2,3-dihydropyran;QIYRGBNUCNZLNY-UHFFFAOYSA-N;Ethanone,1-(3,4-dihydro-6-methyl-2H-pyran-2-yl)-;2-acetyl-3,4-dihydro-6-methyl-2H-pyran;1-(6-Methyl-3,4-dihydro-2H-pyran-2-yl)ethanone
Ethanone,1-(3,4-dihydro-2H-pyrrol-2-yl)- 99583-29-6 C6H9 N O 111.1418
Ethanone,1-(2-pyridinyl)-, 2-(2-pyridinyl)hydrazone 16111-50-5 C12H12 N4 0 N-[(E)-1-pyridin-2-ylethylideneamino]pyridin-2-amine;AB-337/13036073;16111-50-5;NSC332437;ETHANONE,1-(2-PYRIDINYL)-,2-(2-PYRIDINYL)HYDRAZONE;MolPort-019-779-702
Ethanone,1-(2-methyl-4-thiazolyl)- 23002-78-0 C6H7 N O S 141.19 23002-78-0; 1-(2-methylthiazol-4-yl)ethanone; 1-(2-methyl-1,3-thiazol-4-yl)ethanone; 1-(2-Methyl-thiazol-4-yl)-ethanone; Ethanone,1-(2-methyl-4-thiazolyl)-; ST51044692
Ethanone,1-(2-methyl-4-pyrimidinyl)- 67860-38-2 C7H8N2O 136.15122 Ethanone,1-(2-methyl-4-pyrimidinyl)-; Ethanone, 1-(2-methyl-4-pyrimidinyl)- (9CI); 4-ACETYL-2-METHYLPYRIMIDINE; 1-(2-Methyl-4-pyrimidinyl)-ethanone
Ethanone,1-(2-hydroxy-4-methylphenyl)-, oxime 36380-97-9 C9H11 N O2 165.18914;g/mol Ethanone,1-(2-hydroxy-4-methylphenyl)-,oxime;36380-97-9;AC1OAKSB;ZINC5542509;ZINC05542509;ZINC100067343
Ethanone,1-(2-furanyl)-2,2-dihydroxy- 20328-66-9 C6H6 O4 142.11 2-FURANYLGLYOXAL HYDRATE; 1-FURAN-2-YL-2,2-DIHYDROXY-ETHANONE; Furan-2-ylglyoxal hydrate
Ethanone,1-(2-fluorophenyl)-2-(2-methyl-1-piperidinyl)-(9CI) 571152-98-2 C14 H18 F N O 235.297223;g/mol 571152-98-2;AC1NP3N0;CTK5A6305;AKOS008964915;HE354519;KB-213042
Ethanone,1-(2-fluoro-4-pyridinyl)- 111887-72-0 C7H6FNO 139.1270432 Ethanone,1-(2-fluoro-4-pyridinyl)-; Ethanone, 1-(2-fluoro-4-pyridinyl)- (9CI)
Ethanone,1-(2-ethynylcyclopentyl)-,trans- 155222-54-1 C9H12O 136.19098 Ethanone,1-(2-ethynylcyclopentyl)-,trans-; Ethanone, 1-(2-ethynylcyclopentyl)-, trans- (9CI)
Ethanone,1-(2-ethynylcyclohexyl)- 155222-56-3 C10H14O 150.21756 Ethanone,1-(2-ethynylcyclohexyl)-; Ethanone, 1-(2-ethynylcyclohexyl)- (9CI)
Ethanone,1-(2-ethynyl-1-cyclopenten-1-yl)- 247081-34-1 C9H10O 134.1751 Ethanone,1-(2-ethynyl-1-cyclopenten-1-yl)-; Ethanone, 1-(2-ethynyl-1-cyclopenten-1-yl)- (9CI)
Ethanone,1-(2-chloro-4-hydroxy-3-pyridinyl)-(9CI) 526193-61-3 C7H6ClNO2 0 Ethanone,1-(2-chloro-4-hydroxy-3-pyridinyl)-(9CI)
Ethanone,1-(2-amino-4-pyrimidinyl)- 106157-82-8 C6H7N3O 137.13928 2-Amino-4-acetylpyrimidine; 1-(2-Amino-4-pyrimidinyl)ethanone
Ethanone,1-(2-amino-3,4-dimethoxyphenyl)- 49701-79-3 C10H13 N O3 195.21512;g/mol 1-(2-amino-3,4-dimethoxyphenyl)ethanone;1-(2-AMINO-3,4-DIMETHOXYPHENYL)ETHANONE;49701-79-3;Ethanone,1-(2-amino-3,4-dimethoxyphenyl)-;PubChem22815;SCHEMBL10983622
Ethanone,1-(2-amino-3,4-dichlorophenyl)- 777067-75-1 C8H7Cl2NO 204.05300
Ethanone,1-(2,6-dimethyl-4-pyrimidinyl)- 73937-21-0 C8H10N2O 150.1778 Ethanone,1-(2,6-dimethyl-4-pyrimidinyl)-; Ethanone, 1-(2,6-dimethyl-4-pyrimidinyl)- (9CI)
Ethanone,1-(2,3-dihydro-6-hydroxy-1H-indol-1-yl)- 4770-34-7 C10H11 N O2 177.19984;g/mol 1-Acetyl-6-hydroxyindoline;4770-34-7;1-(6-HYDROXYINDOLIN-1-YL)ETHANONE;1-(6-hydroxy-2,3-dihydroindol-1-yl)ethanone;SCHEMBL8141492;PTYHKNCEOYQXTD-UHFFFAOYSA-N

Back to Top