Product Name CAS MF MW Synonyms
(Octadecyl)toluene 94248-04-1 C25H44 344.63
(N-Cyclohexylaminomethyl)methyldiethoxysilane 27445-54-1 C12H27NO2Si 245.43 (N-Cyclohexylaminomethyl)methyldiethoxysilane; [(Methyldiethoxysilyl)methyl]aminocyclohexane
(N-Crotonyl)-(2R)-Bornane-10,2-Sultam 94668-55-0 C14H21NO3S 283.39 (R)-(-)-(2-BUTENOYL)-2,10-CAMPHORSULTAM; (N-CROTONYL)-(2R)-BORNANE-10,2-SULTAM; (N-Crotonyl)-(2R)-bornane-10,2-sultam, (2E)-1-[(3aS,6R,7aR)-Tetrahydro-8,8-dimethyl-2,2-dioxido-3H-3a,6-methano-2,1-benzisothiazol-1(4H)-yl]-2-buten-1-one
(N-BUTYLCYCLOPENTADIENYL)TITANIUM TRICHLORIDE 207740-58-7 C9H13Cl3Ti 275.43 (N-BUTYLCYCLOPENTADIENYL)TITANIUM TRICHLORIDE; N-BUTYLCYCLOPENTADIENYLTITANTRICHLORIDE
(n-Butyl)triphenylphosphonium bromide 1779-51-7 399.31 butyltriphenyl-phosphoniubromide; Phosphonium,butyltriphenyl-,bromide; N-BUTYLTRIPHENYLPHOSPHONIUM BROMIDE; BUTYLTRIPHENYLPHOSPHONIUM BROMIDE; BUTYL TRIPHENYL PHOSPHOROUS BROMIDE; BTPPBR
(N-Acetyl)-(4R)-benzyl-2-oxazolidinone 184363-65-3 C12H13NO3 219.24 (N-Acetyl)-(4R)-benzyl-2-oxazolidinone; (R)-(-)-3-Acetyl-4-benzyl-2-oxazolidinone
(N6-BENZOYL)-5'-O-[(N,N-DIISOPROPYLAMINO)-(2-CYANOETHOXY)PHOSPHINYL]-3'-O-(4,4'-DIMETHOXYTRITYL)-2'-DEOXYADENOSINE 140712-82-9 C47H52N7O8P 873.93 (N6-BENZOYL)-5'-O-[(N,N-DIISOPROPYLAMINO)-(2-CYANOETHOXY)PHOSPHINYL]-3'-O-(4,4'-DIMETHOXYTRITYL)-2'-DEOXYADENOSINE; (N6-BENZOYL)-5''-O-[(N,N-DIISOPROPYLAMINO)-(2-CYANOETHOXY)PHOSPHINYL]-3''-O-(4,4''-DIMETHOXYTRITYL)-2''-DEOXYADENOSINE
(N-4,N-4,2-Trimethyl)-1,4-benzenediamine 2359-53-7 C9H14N2 150.23
(N,N-DIISOPROPYLCARBAMOYL)TRIBUTYLTIN 116858-79-8 C19H41NOSn 418.24 (N,N-DIISOPROPYLCARBAMOYL)TRIBUTYLTIN
(N,N-Diethyl-3-aminopropyl)trimethoxysilane 41051-80-3 C10H25NO3Si 235.4 (3-DIETHYLAMINOPROPYL)TRIMETHOXYSILANE; 3-(N,N-DIETHYLAMINO)PROPYLTRIMETHOXYSILANE; (N,N-DIETHYL-3-AMINOPROPYL)TRIMETHOXYSILANE; (N,N-DIETHYL-3-AMINOPROPYL)TRIMETHYLOXYSILANE; N,N-DIETHYL-3-(TRIMETHOXYSILYL)PROPYLAMINE; (N N-DIETHYL-3-AMINOPROPYL)TRIMETHO
(morpholin-4-ylmethylene)bisphosphonic acid 32545-75-8 C5H13NO7P2 261.106742 (morpholin-4-ylmethylene)bisphosphonic acid; (4-Morpholinylmethylene)bisphosphonic acid; (Morpholinomethylene)bisphosphonic acid
(morpholin-2-yl)methanol 103003-01-6 C5H11NO2 117.15 2-HYDROXYMETHYLMORPHOLINE; 2-MORPHOLINEMETHANOL; MORPHOLIN-2-YL-METHANOL; 2-HYDROXYMETHYLMORPHOLINE 95%
(MOD)2P(O)H 125653-55-6 C18H23O3P 318.35 BIS(3,5-DIMETHYL-4-METHOXYPHENYL)PHOSPHINE OXIDE; (MOD)2P(O)H
(METHYL-VINYL-PHOSPHINOYL)-BENZENE 2234-93-7 C9H11OP 166.156801 (METHYL-VINYL-PHOSPHINOYL)-BENZENE
(Methylthio)methyl isovalerate 72064-62-1 C7H14O2S
(methylthio)benzaldehyde 71750-42-0 C8H8OS 152.21352 (methylthio)benzaldehyde
(METHYLTHIO)ACETONITRILE 35120-10-6 C3H5NS 87.14 (Methylsulfanyl)acetonitrile; Acetonitrile, (methylthio)-; (METHYLTHIO)ACETONITRILE; (METHYLMERCAPTO)ACETONITRILE; (Methylthio)acetonitrile,99%; (METHYLTHIO)ACETONITRILE 99%
(Methylstannylidyne)tris(thioethane-1,2-diyl) tris[(9Z,12Z)-octadeca-9,12-dienoate] 68928-40-5 C61H108O6S3Sn
(METHYL-PYRIDIN-2-YLMETHYL-AMINO)-ACETIC ACID 669083-52-7 C9H12N2O2 180.2 TIMTEC-BB SBB010657; CHEMBRDG-BB 4003360; ASINEX-REAG BAS 08766933; (METHYL-PYRIDIN-2-YLMETHYL-AMINO)-ACETIC ACID; N-METHYL-N-(PYRIDIN-2-YLMETHYL)GLYCINE
(methylimino)diethane-1,2-diyl distearate 13998-76-0 C41H81NO4 652.08614 (methylimino)diethane-1,2-diyl distearate; (Methylimino)diethan-1,2-diyldistearat; Dioctadecanoic acid methyliminobis(2,1-ethanediyl) ester; Einecs 237-800-6
(METHYL-D3)TRIPHENYLPHOSPHONIUM IODIDE 1560-56-1 C19H15D3IP 407.24 (METHYL-D3)TRIPHENYLPHOSPHONIUM IODIDE; (Methyl)triphenylphosphonium Iodide-d3
(Methoxymethyl)trimethylsilane 14704-14-4 C5H14OSi 118.25 Silane, (methoxymethyl)trimethyl-; TRIMETHYLSILYLMETHYL METHYL ETHER; (METHOXYMETHYL)TRIMETHYLSILANE; (METHOXYMETHYL)TRIMETHYLSILANE 95%; trimethylsilyl methyl ether; Trimethyl(methoxymethyl)silane
(methoxymethyl)(methyl)[(trimethylsilyl)methyl]amine 1000890-03-8 C7H19NOSi 161.3174 1-methoxy-N-methyl-N-(trimethylsilylmethyl)methanamine; SCHEMBL751660; MolPort-029-945-162; AKOS006344910; ZINC170013844; DA-16582
(Methanetetrayltetrakis(benzene-4,1-diyl))tetraboronic acid 153035-55-3 C25H24B4O8 495.69
(METHACRYLOXYPROPYL)METHYLSILOXANE, DIMETHYLSILOXANE COPOLYMER 104780-61-2 0 (METHACRYLOXYPROPYL)METHYLSILOXANE, DIMETHYLSILOXANE COPOLYMER; Polydimethylsiloxane, epoxypropoxypropyl terminated, viscosity 100-140 cSt.; Polydimethylsiloxane, epoxypropoxypropyl terminated, viscosity 20-30 cSt.; Siloxanes and Silicones, di-Me, 3-(1-ox
(METHACRYLOXYMETHYL)METHYLDIMETHOXYSILANE 121177-93-3 C8H16O4Si 204.3 (METHACRYLOXYMETHYL)METHYLDIMETHOXYSILANE
(METHACRYLOXYMETHYL)BIS(TRIMETHYLSILOXY)METHYLSILANE 18166-40-0 C12H28O4Si3 320.6 (METHACRYLOXYMETHYL)BIS(TRIMETHYLSILOXY)METHYLSILANE
(Met(O)5)-Enkephalin 60283-51-4 C27H35N5O8S 589.66 TYR-GLY-GLY-PHE-MET(O); (MET(O)5)-ENKEPHALIN; H-TYR-GLY-GLY-PHE-MET(O)-OH; enkephalin-Met, sulfoxide-
(MET(O)27)-GRF (HUMAN) 90896-48-3 0 (MET(O)27)-GRF (1-44) (HUMAN); (MET(O)27)-GRF (HUMAN); (MET(O)27)-GROWTH HORMONE-RELEASING FACTOR (HUMAN); H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET(O)-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN
(Mesitylmethyl)hydrazine 143425-78-9 C10H16N2 (Mesitylmethyl)hydrazine; 2,4,6-Trimethyl-benzyl-hydrazine
(L-Leucinethiol)2 . 2 HCl, (Disulfide bond) 112157-33-2 C12H28N2S2 . 2 HCl 337.42 2-AMINO-4-METHYL-1-PENTANETHIOL DISULFIDE 2 HCL; (L-LEUCINETHIOL)2 2 HCL; L-LEUCINETHIOL DISULFIDE 2HCL; 2-Amino-4-methyl-1-pentanethiol disulfide dihydrochloride; bis(1-thio-2-amino-4-methylpentane); (L-Leucinethiol)2 . 2 HCl, (Disulfide bond)
(LEU31,PRO34)-NEUROPEPTIDE Y (13-36) (HUMAN, RAT) 302798-54-5 C134H206N40O35S 2969.38 (LEU31,PRO34)-NEUROPEPTIDE Y (13-36) (HUMAN, RAT); (LEU31,PRO34)-NPY (13-36) (HUMAN, RAT); H-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-LEU-THR-ARG-PRO-ARG-TYR-NH2; H-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr
(L)-Ornithine 2-oxoglutarate 34414-83-0 C5H12N2O2.xC5H6O5 0 L-Ornithine, 2-oxopentanedioate; Einecs 252-003-3
(L)-Ethyl 3-(4-Aminophenyl)-2-(1,3-Dioxoisoindolin-2-yl)Propanoate 74743-23-0 C19H18N2O4 338.36 α -[(4-aminophenyl)methyl]-1,3-dihydro-1,3-dioxo-2H-isoindole-2-acetic acid ethyl ester; 4-Amino-L-phenyl-N-phthalylalanine ethyl ester; Ethyl 3-(4-aminophenyl)-2-(1,3-dioxoisoindol-2-yl)propanoate
(L)-2-DIAZOACETYL-PYRROLIDINE-1-CARBOXYLIC ACID TERT-BUTYL ESTER 101130-03-4 C11H17N3O3 239.27 (L)-2-DIAZOACETYL-PYRROLIDINE-1-CARBOXYLIC ACID TERT-BUTYL ESTER; (L)-2-Diazoacetyl-pyrrolidine-1-carboxylic acid tertiary-butyl ester
(L)-2-[(T-BOC)AMINO]-2-[(5-FLUORESCEINYL)AMINOCARBONYL]ETHYL METHANETHIOSULFONATE 1042688-20-9 C29H28N2O11S 612.6 (L)-2-[(T-BOC)AMINO]-2-[(5-FLUORESCEINYL)AMINOCARBONYL]ETHYL METHANETHIOSULFONATE; T-BOC-MTSEA-FLUORESCEIN
(Isoquinolin-8-yl)methanol 76518-57-5 C10H9NO 159.18 RARECHEM AL BD 1523; ISOQUINOLINE-5-METHANOL; 5-HYDROXYMETHYLISOQUINOLINE; 5-ISOQUINOLINEMETHANOL; AKOS P-2123556; 8-(HYDROXYMETHYL)ISOQUINOLINE; ISOQUINOLIN-8-YLMETHANOL
(Isopropoxymethoxy)methanol 100208-41-1 C5H12O3
(ISOCYANATOMETHYL)METHYLDIMETHOXYSILANE 406679-89-8 C5H11NO3Si 161.23124 (ISOCYANATOMETHYL)METHYLDIMETHOXYSILANE; (isocyanatomethyl)methyldimethoxysilane,85% contains(methyldimethoxysilylmethyl)ethylcarbamate; Silane, (isocyanatomethyl)dimethoxymethyl-
(Isobutylamino)(oxo)acetic acid 75235-38-0 C6H11NO3 145.16
(INDOL-3-YLTHIO)ACETONITRILE 61021-51-0 C10H8N2S 188.25 (INDOL-3-YLTHIO)ACETONITRILE
(IMINO-[1,2,4]TRIAZOL-1-YL-METHYL)-CARBAMIC ACID TERT-BUTYL ESTER 887407-15-0 C8H13N5O2 211.22 (IMINO-[1,2,4]TRIAZOL-1-YL-METHYL)-CARBAMIC ACID TERT-BUTYL ESTER
(hydroxymethyl)thiourea 1000-83-5 C2H6N2OS 106.14684 (hydroxymethyl)thiourea; N-(Hydroxymethyl)thiourea
(Hydroxymethyl)ethylene bis(dihydrogen phosphate), compound with cyclohexylamine (1:5) 95648-80-9
(Hydroxyborylene)bis[oxy(2-hydroxypropane-1,3-diyl)] distearate 93777-11-8 C42H83BO9 742.91402 (hydroxyborylene)bis[oxy(2-hydroxypropane-1,3-diyl)] distearate; Bis(octadecanoic acid)(hydroxyboranediyl)bis[oxy(2-hydroxy-3,1-propanediyl)] ester
(Hydroxy(methanesulfonyloxy)iodo)benzene 105551-42-6 C7H9IO4S 316.11 [HYDROXY(METHANESULFONYLOXY)IODO]BENZENE; [HYDROXY(MESYLOXY)IODO]BENZENE; PHENYLIODOSOHYDROXY METHANESULFONATE
(Hydrazinocarbonyl)ferrocene 12153-28-5 C11H12FeN2O 244.07 (HYDRAZINOCARBONYL)FERROCENE; FERROCENECARBOHYDRAZIDE; (Hydrazinocarbonyl)ferrocene [for; (HYDRAZINOCARBONYL)FERROCENE [FOR HPLC LABELING] 95+%; (Hydrazinocarbonyl)ferrocene [for HPLC Labeling]; (S)-Ferrocenyl p-Tolyl Sulfoxide
(H-Gly-Cys-OH)2, (Disulfide bond) 26798-52-7 C10H18N4O6S2 354.4031 (H-GLY-CYS-OH)2; (H-Gly-Cys-OH)2 (Disulfide bond)
(H-GLY)2-(CYS-OH)2 26584-84-9 C10H22N4O8S2 390.43 (H-GLY)2-(CYS-OH)2; (H-GLY)2-(CYS-OH)2-2H2O; DIGLYCYL-L-CYSTINE DIHYDRATE
(Hexyloxy)acetic acid 57931-25-6 C8H16O3
(Hexyl)-triethoxysilane 18166-37-5 CH3(CH2)5Si(OCH2CH3)3 248.43 (Hexyl)-triethoxysilane; Hexyltriethoxysilane
(Hexamethylbenzene)ruthenium(II) dichloride dimer 67421-02-7 C24H36Cl4Ru2 668.49 DICHLORO(HEXAMETHYLBENZENE)RUTHENIUM(II) DIMER; (HEXAMETHYLBENZENE)RUTHENIUM(II) DICHLORIDE DIMER
(hexadecan-1-olato)(octadecanoato-O)(propan-2-olato)aluminium 71411-85-3 C37H75AlO4 0 (hexadecan-1-olato)(octadecanoato-O)(propan-2-olato)aluminium
(HEPTAFLUOROPROPYL)TRIMETHYLSILANE 3834-42-2 C6H9F7Si 242.21
(Heneicosafluorodecyl)-ethylene 30389-25-4 C12H3F21 546.12 (Heneicosafluorodecyl)-ethylene; (Perfluorodecyl)ethylene
(H-Cys-Val-OH)2, (Disulfide bond) 21141-84-4 C16H30N4O6S2 438.56 L-CYSTINYL-BIS-L-VALINE; (H-CYS-VAL-OH)2; (H-Cys-Val-OH)2 (Disulfide bond)
(H-Cys-Tyr-OH)2, (Disulfide bond) 7369-94-0 C24H30N4O8S2 566.647 L-CYSTINYL-BIS-L-TYROSINE; (H-CYS-TYR-OH)2; (H-Cys-Tyr-OH)2 (Disulfide bond)
(H-Cys-Phe-OH)2, (Disulfide bond) 62130-80-7 C24H30N4O6S2 534.6482 (H-CYS-PHE-OH)2; L-CYSTINYL-BIS-L-PHENYLALANINE; (H-Cys-Phe-OH)2 (Disulfide bond); L-Cystinyl-bis-phenylalanine
(H-Cys-Ala-OH)2, (Disulfide bond) 20898-21-9 C12H22N4O6S2 382.46 (H-CYS-ALA-OH)2; (H-Cys-Ala-OH)2 (Disulfide bond)
(Gly14)-Humanin (human) 330936-70-4 C118H202N34O31S2 2657.21 MET-ALA-PRO-ARG-GLY-PHE-SER-CYS-LEU-LEU-LEU-LEU-THR-GLY-GLU-ILE-ASP-LEU-PRO-VAL-LYS-ARG-ARG-ALA; MET-ALA-PRO-ARG-GLY-PHE-SER-CYS-LEU-LEU-LEU-LEU-THR-GLY-GLU-ILE-ASP-LEU-PRO-VAL-LYS-ARG-ARG-ALA TRIFLUOROACETATE; MAPRGFSCLLLLTGEIDLPVKRRA; H-MET-ALA-PRO-ARG-
(Gly106)-Cytochrome C (92-107) (Manduca sexta) 213260-63-0 C77H129N23O24 1760.99 MCCPT102G; H-ALA-ASN-GLU-ARG-ALA-ASP-LEU-ILE-ALA-TYR-LEU-LYS-GLN-ALA-GLY-LYS-OH; (GLY102,LYS103)-CYTOCHROME C (88-103); (GLY102,LYS103)-CYTOCHROME C (88-103) (MACROBRACHIUM MALCOLMSONII); [GLY102]-MCC (88-103); (GLY106)-CYTOCHROME C (92-107); (GLY106)-CYT
(Glu8,9)-Helodermin 209340-47-6 C176H283N45O51 0 (GLU8,9)-HELODERMIN
(D-gluconato-O1,O2)silver 94276-84-3 C6H11AgO7 0 (D-gluconato-O1,O2)silver
(E)-(4-methoxy-2,3,6-trimethylphenyl)-3-buten-2-one 62924-31-6 C14H18O2 218.29152 (E)-(4-methoxy-2,3,6-trimethylphenyl)-3-buten-2-one; (E)-4-(2,3,6-Trimethyl-4-methoxyphenyl)-3-butene-2-one; (E)-4-(4-Methoxy-2,3,6-trimethylphenyl)-3-buten-2-one
(FURFURYL)(2-PYRIDYLMETHYL)AMINE 247571-56-8 C11H12N2O 188.23 AKOS B023149; ART-CHEM-BB B023149; FURAN-2-YLMETHYL-PYRIDIN-2-YLMETHYL-AMINE; (FURFURYL)(2-PYRIDYLMETHYL)AMINE; CHEMBRDG-BB 4101656; TIMTEC-BB SBB007195
(FURAN-2-YLMETHANESULFINYL)-ACETIC ACID METHYL ESTER 864759-49-9 C8H10O4S 202.2276 (FURAN-2-YLMETHANESULFINYL)-ACETIC ACID METHYL ESTER
(ETHYLTHIO)ACETIC ACID 627-04-3 C4H8O2S 120.17 (ETHYLTHIO)ACETIC ACID; (ethylthio)-aceticaci; S-Ethylthioglycolic acid; 2-(Ethylthio)acetic acid; 2-ethylsulfanylacetic acid; 2-ethylsulfanylethanoic acid
(Ethoxycarbonylmethyl)diphenylphosphine oxide 6361-5-3
(ETHOXYCARBONYLMETHYL)DIPHENYLPHOSPHINE 6361-05-3 C16H17O2P 272.28 (ETHOXYCARBONYLMETHYL)DIPHENYLPHOSPHINE; ETHYL DIPHENYLPHOSPHINOACETATE; AURORA KA-1132; (Ethoxycarbonylmethyl)diphenylphosphine oxide, 97 %
(Ethenyloxy)-butanol 42978-84-7 C6H12O2 116.15800
(ETHANEDIYLIDENETETRATHIO)TETRAACETIC ACID 10003-69-7 C10H14O8S4 390.47 2,2',2'',2'''-[1,2-ethanediylidenetetrakis(thio)]tetrakis-aceticaci; 2,2',2''2'''-(1,2-ETHANEDIYLIDENE-TETRAKIS[THIO])-TETRAKIS-ACETIC ACID; (ETHANEDIYLIDENETETRATHIO)TETRAACETIC ACID; 2,2',2'',2'''-[1,2-ethanediylidenetetrakis(thio)]tetraacetic acid; (ET
(E/Z)-Phytoene 540-04-5
(E,Z)-trideca-4,7-dien-1-yl acetate 61389-12-6 C15H26O2
(E,Z)2-propyl-2,4-pentadienoic acid 72010-18-5 C8H12O2 0 (E,Z) 2-Propyl-2,4-pentadienoic Acid; 2,4-diene-VP; 2-propyl-2,4-pentadienoic acid; 2,4-diene-VPA
(E,Z)-2-(2-Benzyloxycarbonylamino-4-thiazol)-4-(3-methyl-2-butenyloxycarbonyl)-2-butenoic acid 155657-19-5 C21H22N2O6S 430.48 (e,z)-2-(2-benzyloxycarbonylamino-4-thiazol)-4-(3-methyl-2-butenyloxycarbonyl)-2-butenoic acid
(E,Z) 3,13-Octadecadiene-1-ol 66410-28-4
(E,E)-undeca-1,3,5-triene 19883-29-5 C11H18 150.26062 (E,E)-undeca-1,3,5-triene; (3E,5E)-1,3,5-Undecatriene; Einecs 243-398-3
(E,E)FARNESOIC ACID, 95+% DRY ICE ITEM 462-11-3 C15H24O2 236.35000
(E,E)-4,4'-Bis[2-(4-methoxyphenyl)ethenyl]-2,2'-bipyridine 166827-53-8 C28H24N2O2 420.50
(E,E)-4,4'-(9,10-Anthracenediyldi-2,1-ethenediyl)bis[N,N-diphenylbenzenamine] 155139-11-0 C54H40N2 716.91 (E,E)-4,4'-(9,10-Anthracenediyldi-2,1-ethenediyl)bis[N,N-diphenylbenzenamine]
(5-Bromopyridin-2-ylcarbonyl)morpholine 957063-06-8 C10H11BrN2O2 0 (5-Bromopyridin-2-ylcarbonyl)morpholine; 5-bromo-2-morpholinocarbonylpyridine; 4-[(5-Bromopyridin-2-yl)carbonyl]morpholine; 5-Bromo-2-(morpholin-4-ylcarbonyl)pyridine; PY-71955-bromo-2-morpholinocarbonylpyridine
(5-BROMO-PYRIDIN-2-YL)-PHENYL-METHANOL 181647-50-7 C12H10BrNO 264.12 (5-BROMO-PYRIDIN-2-YL)-PHENYL-METHANOL
(5-BROMOPYRIDIN-2-YL)-2-DIMETHOXYETHYL AMINE 474708-93-5 C9H13BrN2O2 261.12 (5-BROMO-PYRIDIN-2-YL)-(2,2-DIMETHOXY-ETHYL)-AMINE; (5-BROMOPYRIDIN-2-YL)-2-DIMETHOXYETHYL AMINE; 5-Bromo-N-(2,2-dimethoxyethyl)pyridin-2-amine; 5-bromo-N-(2,2-dimethoxyethyl)-2-Pyridinamine; 5-bromo-N-(2,2-dimethoxyethyl)-2-pyridin-2-amine
(5-Bromopyridin-2-yl)[2-(tert-butyldimethylsilyloxy)ethyl]methylamine 326496-01-9 C14H25BrN2OSi 345.35 5-Bromo-N-[2-[[(1,1-dimethylethyl)dimethylsilyl]oxy]ethyl]-N-methyl-2-pyridinamine;
(5-Bromopyridin-2-yl)(pyrrolidin-1-yl)methanone 742085-70-7 C10H11BrN2O 0 (5-Bromopyridin-2-yl)(pyrrolidin-1-yl)methanone; 5-Bromo-2-(pyrrolidin-1-ylcarbonyl)pyridine; 1-(5-Bromopyridin-2-ylcarbonyl)pyrrolidine
(5-Bromopicolinoyl)piperidine 934000-33-6 C11H13BrN2O 0 (5-Bromopicolinoyl)piperidine, (5-Bromopyridin-2-yl)(piperidin-1-yl)methanone; (5-Bromopicolinoyl)piperidine; (5-Bromopyridin-2-yl)(piperidin-1-yl)Methanone
(5-Bromobenzo[b]furan-2-yl) methyl amine 165736-51-6 C9H8BrNO 226.07 (5-BROMOBENZO[B]FURAN-2-YL)METHYLAMINE; 5-BROMO-2-METHYLAMINEBENZOFURAN
(5-BROMO-6-CHLORO-PYRIDIN-3-YL)-CARBAMIC ACID TERT-BUTYL ESTER 405939-59-5 C10H12BrClN2O2 307.57 TERT-BUTYL (5-BROMO-6-CHLOROPYRIDIN-3-YL)CARBAMATE; (5-BROMO-6-CHLORO-PYRIDIN-3-YL)-CARBAMIC ACID TERT-BUTYL ESTER
(4-Perfluorotolyl)acetic acid 32304-29-3 C9H3F7O2 276.107
(4-Oxo-piperidin-1-yl)-phenyl-acetic acid 886363-69-5 C13H15NO3 233.26
(4-Oxo-piperidin-1-yl)-acetic acid 218772-96-4 C7H11NO3 193.63 (4-Oxo-piperidin-1-yl)-acetic acid; (4-Oxo-piperidin-1-yl)acetic acid hydrochloride
(4-OXO-5-THIOPHEN-2-YLMETHYLENE-2-THIOXO-THIAZOLIDIN-3-YL)-ACETIC ACID 82158-62-1 C10H7NO3S3 285.36 CHEMBRDG-BB 5559128; (4-OXO-5-THIOPHEN-2-YLMETHYLENE-2-THIOXO-THIAZOLIDIN-3-YL)-ACETIC ACID; [(5Z)-4-OXO-5-(2-THIENYLMETHYLENE)-2-THIOXO-1,3-THIAZOLIDIN-3-YL]ACETIC ACID; 2-[(5Z)-4-OXO-2-SULFANYLIDENE-5-(THIOPHEN-2-YLMETHYLIDENE)-1,3-THIAZOLIDIN-3-YL]ACET
(4-OXO-5,6,7,8-TETRAHYDRO-4H-BENZO[4,5]THIENO[2,3-D]PYRIMIDIN-3-YL)-ACETIC ACID METHYL ESTER 450376-42-8 C13H14N2O3S 278.33 AURORA 20936; (4-OXO-5,6,7,8-TETRAHYDRO-4H-BENZO[4,5]THIENO[2,3-D]PYRIMIDIN-3-YL)-ACETIC ACID METHYL ESTER; 5,6,7,8-TETRAHYDRO-[1]-BENZOTHIENO[2,3-D]PYRIMIDIN-4-OXO-3(4H)-ACETIC ACID METHYL ESTER
(4-OXO-3,4,5,6,7,8-HEXAHYDRO-BENZO[4,5]THIENO[2,3-D ]PYRIMIDIN-2-YLSULFANYL)-ACETIC ACID 112672-69-2 C12H12N2O3S2 296.37 (4-OXO-3,4,5,6,7,8-HEXAHYDRO-BENZO[4,5]THIENO[2,3-D ]PYRIMIDIN-2-YLSULFANYL)-ACETIC ACID; AKOS BBS-00007179; CHEMBRDG-BB 5753637; [(4-OXO-3,4,5,6,7,8-HEXAHYDRO[1]BENZOTHIENO[2,3-D]PYRIMIDIN-2-YL)THIO]ACETIC ACID; OTAVA-BB 0107600043
(4-oxo-3(4H)-quinazolinyl)acetic acid 14663-53-7 C10H8N2O3 204.18 CHEMBRDG-BB 4001974; (4-OXO-4H-QUINAZOLIN-3-YL)-ACETIC ACID; (4-OXOQUINAZOLIN-3(4H)-YL)ACETIC ACID; AKOS BB69; ASISCHEM D51303; OTAVA-BB 7010160005
(4-Oxo-1,2,3-benzotriazin-3(4H)-yl)acetic acid 97609-01-3 C9H7N3O3 205.17
(4-Bromo-2-fluorophenyl) 1,1,2,3,3,3-hexafluoropropyl ether 161045-76-7 C9H4BrF7O 341.0202824 (4-Bromo-2-fluorophenyl) 1,1,2,3,3,3-hexafluoropropyl ether
(4-Bromo-2-chlorophenyl)methanol 185315-48-4 C7H6BrClO 0 (4-Bromo-2-chlorophenyl)methanol; 4-Bromo-2-chlorobenzyl alcohol
(4-Bromo-2-chlorophenoxy)acetic acid 77228-67-2 C8H6BrClO3 265.48800
(4-BROMO-2-CHLORO-6-FLUOROPHENYL)-1,1,2,3,3,3-HEXAFLUOROPROPYL ETHER 161045-78-9 C9H3BrClF7O 375.47 (4-BROMO-2-CHLORO-6-FLUOROPHENYL)-1,1,2,3,3,3-HEXAFLUOROPROPYL ETHER
(4-Benzyloxy-benzyl)-hydrazine 207233-86-1 C14H16N2O 228.29 (4-BENZYLOXY-BENZYL)-HYDRAZINE
(4-BENZYL-MORPHOLIN-2-YLMETHYL)-ETHYL-AMINE 868770-14-3 C14H22N2O 234.34 N-((4-NENZYLMORPHOLIN-2-YL)METHYL)ETHANAMINE; (4-BENZYL-MORPHOLIN-2-YLMETHYL)-ETHYL-AMINE
(4-BENZYL-MORPHOLIN-2-YLMETHYL)-DIMETHYL-AMINE 122894-38-6 C14H22N2O 234.34 (4-BENZYLMORPHOLIN-2-YL)-N,N-DIMETHYLMETHANAMINE; (4-BENZYL-MORPHOLIN-2-YLMETHYL)-DIMETHYL-AMINE
(4-BENZYL-MORPHOLIN-2-YLMETHYL)-DIETHYL-AMINE 147465-50-7 C16H26N2O 262.39 (4-BENZYL-MORPHOLIN-2-YLMETHYL)-DIETHYL-AMINE; N-[(4-BENZYLMORPHOLIN-2-YL)METHYL]-N-ETHYLETHANAMINE
(3S)-6,6-DIMETHYL-5-OXOTHIOMORPHOLINE-3-CARBOXYLIC ACID 14226-94-9
(3S)-5-ethoxy-3-hydroxy-5-oxopentanoic acid 95310-87-5 C7H12O5 176.1672
(3S)-4-BOC-1-CARBOXYMETHYL-3-BENZYL-PIPERAZIN-2-ONE 215121-89-4 C18H24N2O5 348.39 (3S)-4-BOC-1-CARBOXYMETHYL-3-BENZYL-PIPERAZIN-2-ONE
(3S)-4,4,4-Trifluoro-1-(4-methylbenzenesulfonate)-1,3-Butanediol 176640-87-2 C11H13F3O4S 298.27873;g/mol [(3S)-4,4,4-trifluoro-3-hydroxybutyl]4-methylbenzenesulfonate;176640-87-2;(3S)-4,4,4-Trifluoro-1-(4-methylbenzenesulfonate)-1,3-Butanediol;PubChem11295;SCHEMBL7634789;ZINC34221395
(3S)-3-Z-AMINO-1-DIAZO-4-METHYL-2-PENTANONE 28094-73-7 C14H17N3O3 275.3 N-ALPHA-BENZYLOXYCARBONYL-L-VALINYL-DIAZOMETHANE; Z-L-VAL-CHN2; (3S)-3-Z-AMINO-1-DIAZO-4-METHYL-2-PENTANONE
(3S)-3-tert-Butyloxy-4-(9-fluorennylmethoxy)-carbonylaminobutyric Acid 916892-17-6 C23H27NO5 397.46400
(3S)-3-Methyl-4-(tert-buty)diphenylsilyloxy)butanal 123444-68-8 C21H28O2Si 0 (3S)-3-Methyl-4-(tert-buty)diphenylsilyloxy)butanal
(3aR,4R,5R,6aS)-5-(Benzoyloxy)hexahydro-4-(3-oxo-1-oCten-1-yl)-2H-cyclopenta[b]furan-2-one 185225-06-3 C22H26O5 370.44
(3aR,4R,5R,6aS)-4-[(1E,3R)-4-(3-Chlorophenoxy)-3-hydroxy-1-buten-1-yl]-5-hydroxyhexahydro-2H-cyclopenta[b]furan-2-one 53906-54-0
(3aR,4R,5R,6aS)-4-[(1E)-4-(3-Chlorophenoxy)-3-oxo-1-buten-1-yl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one 53872-62-1 C17H17ClO5 336.769 ENONE-C; (3aR,4R,5R,6aS)-4-[(1E)-4-(3-Chlorophenoxy)-3-oxo-1-buten-1-yl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one
(3aR,4R,5R,6aS)-4-[(1E)-4-(3-Chlorophenoxy)-3-hydroxy-1-buten-1-yl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one 652152-39-1 C17H19ClO5 338.78300
(3aR,4aS,7S,8aS)-7-Bromo-3a,4a,5,6,7,8,8a,9-oCtahydro-4a,8,8-trimethyl-furo[3,4-b][1]benzoxepin-1(3H)-one 62003-89-8 C15H21BrO3 329.23
(3aR,4aS,7S,8aS)-7-Bromo-1,3,3a,4a,5,6,7,8,8a,9-decahydro-4a,8,8-trimethylfuro[3,4-b][1]benzoxepin 77249-86-6 C15H23BrO2 315.24
(3aR,4aS,7S,8aR,9aR)-7-hydroxy-8a-methyl-3,5-dimethylidene-3a,4,4a,6,7,8,9,9a-octahydrobenzo[f][1]benzofuran-2-one 5938-03-4 C15H20O3 248.318 g/mol
(2S,4S)-4-(Acetylthio)-2-(hydroxymethyl)-1-pyrrolidinecarboxylic acid 1,1-dimethylethyl ester 148017-42-9 C12H21NO4S 0 1-Pyrrolidinecarboxylic acid, 4-(acetylthio)-2-(hydroxymethyl)-, 1,1-dimethylethyl ester, (2S,4S)-
(2S,4S)-2-Methyltetrahydro-2H-Pyran-4-Ol 82110-13-2 C6H12O2
(1H-BENZOIMIDAZOL-5-YL)-CARBAMIC ACID TERT-BUTYL ESTER 885270-97-3 C12H15N3O2 233.27 (1H-BENZOIMIDAZOL-5-YL)-CARBAMIC ACID TERT-BUTYL ESTER; 5-BOC-AMINO-BENZOIMIDAZOLE
(1H-benzoimidazol-2-ylmethyl)methylamine 98997-01-4 C9H11N3 161.2 (1H-BENZOIMIDAZOL-2-YLMETHYL)-METHYL-AMINE; N-(1H-BENZIMIDAZOL-2-YLMETHYL)-N-METHYLAMINE; TIMTEC-BB SBB010432; 1H-Benzimidazole-2-methanamine,N-methyl-(9CI)
(1H-BENZOIMIDAZOL-2-YLMETHOXY)-ACETIC ACID 783284-17-3 C10H10N2O3 206.2 (1H-BENZOIMIDAZOL-2-YLMETHOXY)-ACETIC ACID; CHEMBRDG-BB 4001610; (1H-Benzimidazol-2-ylmethoxy)acetic acid; AKOS TUR-0059; ALINDA 7230; ART-CHEM-BB B036356
(1H-BENZO[D][1,2,3]TRIAZOL-5-YL)METHANOL 106429-67-8 C7H7N3O 149.14998 (1H-BENZO[D][1,2,3]TRIAZOL-5-YL)METHANOL
(1H,1H,2H,2H-PERFLUORO-N-HEXYL)METHYLDICHLORO-SILANE 38436-16-7 C7H7Cl2F9Si 361.11
(1-FURAN-2-YL-ETHYL)-(3-METHYL-1-PHENYL-BUT-3-ENYL)-AMINE 436096-85-4 C17H21NO 255.35 (1-FURAN-2-YL-ETHYL)-(3-METHYL-1-PHENYL-BUT-3-ENYL)-AMINE
(1-FURAN-2-YL-ETHYL)-(1-PHENYL-BUT-3-ENYL)-AMINE 436088-63-0 C16H19NO 241.33 (1-FURAN-2-YL-ETHYL)-(1-PHENYL-BUT-3-ENYL)-AMINE
(E,E)-1-[4-(1-Methylethyl)phenyl]-5-phenyl-1,4-pentadien-3-one 174493-20-0 C20H20O 276.37 1-phenyl-5-(4-propan-2-ylphenyl)penta-1,4-dien-3-one; (E,E)-1-[4-(1-METHYLETHYL)PHENYL]-5-PHENYL-1,4-PENTADIEN-3-ONE; 174493-20-0
(E,E)-[5-(4-methoxy-2,3,6-trimethylphenyl)-3-methyl-2,4-pentadienyl]triphenylphosphonium chloride 69365-97-5 C34H36ClOP 527.075801 (E,E)-[5-(4-methoxy-2,3,6-trimethylphenyl)-3-methyl-2,4-pentadienyl]triphenylphosphonium chloride
(E)-tetradec-12-enyl acetate 35153-21-0 C16H30O2 254.4082 (E)-tetradec-12-enyl acetate; (E)-12-Tetradecen-1-ol acetate; Acetic acid (12E)-12-tetradecenyl ester; (E)-12-Tetradecenyl acetate
(E)-tert-Butyl 3-(4-formylphenyl)acrylate 144374-53-8 C14H16O3 0 (E)-tert-Butyl 3-(4-formylphenyl)acrylate
(E)-Pent-2-enyl butyrate 42125-30-4 C9H16O2
(E)-Pent-2-en-1-yl acetate 42125-28-0 C7H12O2
(E)-Oct-5-en-2-one 19093-20-0
(E)-Oct-2-enyl acetate 3913-80-2 C10H18O2 170.24872 (E)-oct-2-enyl acetate; TRANS-2-OCTEN-1-YLACETATE; (E)-2-Octen-1-ol acetate
(E)-non-2-enoic acid 14812-03-4 C9H16O2 156.22214;g/mol (E)-non-2-enoicacid;2-Nonenoicacid;Nonylenicacid;(E)-Non-2-enoicacid;trans-2-Nonenoicacid;2-Nonenylicacid
(E)-N-methyl-2-(3-(2-(pyridin-2-yl)vinyl)-1-(tetrahydro-2H-pyran-2-yl)-1H-indazol-6-ylthio)benzamide 885126-35-2 C27H26N4O2S 470.59
(E)-N-benzylidene-2-ethoxypropan-1-amine 105427-39-2
(E)-N-3-(IODOPROP-2-ENYL)2E-CARBOXY-3E-(P-TOLYL)-NORTROPAN 311351-26-5 C18H22INO2 411.28 PE2I ACID; (E)-N-3-(IODOPROP-2-ENYL)2E-CARBOXY-3E-(P-TOLYL)-NORTROPAN; 8-AZABICYCLO[3.2.1]OCTANE-2-CARBOXYLIC ACID, 8-[(2E)-3-IODO-2-PROPENYL]-3-(4-METHYLPHENYL)-, (1R,2S,3S,5S)-; (E)-N-(3-Iodoprop-2-enyl)-2beta-carboxy-3beta-(p-tolyl)-nortropan; 8-Azabic
(E)-N-[2-[2-[(2S)-1-methyl-2-piperidyl]ethyl]phenyl]-3-phenyl-prop-2-e namide 58754-46-4 C23H28N2O 0 (E)-N-[2-[2-[(2S)-1-methyl-2-piperidyl]ethyl]phenyl]-3-phenyl-prop-2-e namide; iferanserin
(E)-N,N-dimethyl-3-[2-(trifluoromethyl)-9H-thioxanthen-9-ylidene]propylamine 47346-96-3 C19H18F3NS 349.4131296 (E)-N,N-dimethyl-3-[2-(trifluoromethyl)-9H-thioxanthen-9-ylidene]propylamine
(E)-N-(4-BROMO-3-METHYLPHENYL)-3-(3-PHENOXYPHENYL)-2-PROPENAMIDE 478258-27-4 C22H18BrNO2 408.29 (E)-N-(4-BROMO-3-METHYLPHENYL)-3-(3-PHENOXYPHENYL)-2-PROPENAMIDE; SALOR-INT L232629-1EA; N-(4-BROMO-3-METHYLPHENYL)-3-(3-PHENOXYPHENYL)ACRYLAMIDE
(E)-N-(1-imidazol-1-yl-2-propoxyethylidene)-4-chloro-2-trifluoro-o-toluidine 99387-89-0 C15H15ClF3N3O 345.75 (E)-1-(1-((4-Chloro-2-(trifluoromethyl)phenyl)imino)-2-propoxyethyl)-1H-imidazole; Triflumizole; (E)-N-[4-Chloro-2-(trifluoromethyl)phenyl]-1-(1H-imidazol-1-yl)-2-(propyloxy)ethanimine; 4-Chloro-N-[(E)-1-(1H-imidazol-1-yl)-2-propoxyethylidene]-2-(trifluor
(E)-methyl 5-(4-fluorophenyl)-3-oxopent-4-enoate 144224-15-7 C12H11FO3 222.21 5-(4-Fluorophenyl)-3-oxo-4-pentenoic acid methyl ester; (E)-Methyl 5-(4-fluorophenyl)-3-oxopent-4-enoate
(E)-METHYL 4-(1H-INDOL-3-YL)-4-OXOBUT-2-ENOATE 59000-14-5 C13H11NO3 229.23
(E)-Methyl 3,4,5-trimethoxycinnamate 20329-96-8
(E)-methyl 3-(4-cyanophenyl)acrylate 67472-79-1
(E)-methyl 3-(3-fluorophenyl)acrylate 74325-03-4
(E)-methyl 3-(2-chloro-4-((3-(2,6-dichlorophenyl)-5-isopropylisoxazol-4-yl)methoxy)styryl)benzoate 933799-50-9
(E)-Hex-3-enyl butyrate 53398-84-8 C10H18O2
(E)-HEPTENYLDIISOPROPYLSILANOL 261717-41-3 C13H28OSi 0 (E)-HEPTENYLDIISOPROPYLSILANOL
(E)-Hept-3-enyl acetate 1576-77-8 C9H16O2
(E)-hept-2-enyl isovalerate 94109-97-4 C12H22O2
(E)-Guggulsterone 39025-24-6 312.45 (17E)-Pregna-4,17(20)-diene-3,16-dione
(E)Ethyl 4-(3,4-dimethoxyphenyl)-4-oxo-2-butenoate (VAC) 80937-23-1
(E)-Ethyl 3-(2-bromo-4-(bromomethyl)phenyl)acrylate 864759-54-6 C12H12Br2O2 348.03 (E)-ETHYL 3-(2-BROMO-4-(BROMOMETHYL)PHENYL)ACRYLATE; (E)-Ethyl 3-(2-bromo-4-(bromomethyl)phenyl)acrylate >97%
(E)-Ethyl 3-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)acrylate 1132669-74-9 C17H23BO4 0 (E)-Ethyl 3-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)acrylate
(E)-Diisobutyl(6-methylhept-3-en-1-olato)aluminum 68900-79-8 C16H33AlO
(E)-C-HDMAPP (ammonium salt) 933030-60-5
(E)-Ceftriaxone 92143-31-2 C18H18N8O7S3 554.58 (6R,7R)-7-[[(2E)-2-(2-Amino-4-thiazolyl)-2-(methoxyimino)acetyl]amino]-8-oxo-3-[[(1,2,5,6-tetrahydro-2-methyl-5,6-dioxo-1,2,4-triazin-3-yl)thio]methyl]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic Acid; Ro 15-2254;
(E)-Buten-3-ynyl-2,6,6-trimethyl-1-cyclohexene 73395-75-2 C13H18 174.28 (E)-BUTEN-3-YNYL-2,6,6-TRIMETHYL-1-CYCLOHEXENE
(E)-Benzyl 4-bromostyrylcarbamate 1228957-12-7 C16H14BrNO2 0 (E)-Benzyl 4-bromostyrylcarbamate; 1-Bromo-4-(2-cbz-amino)vinylbenzene
(E)-9-Hexadecenoic acid methyl ester 10030-74-7 C17H32O2 268.43 (E)-9-Hexadecenoic acid methyl ester; Methyl palmitelaidate
(E)-8-Hydroxy-2-[2-(3,4,5-trihydroxyphenyl)ethenyl]-7-quinolinecarboxylic acid sodium salt 210890-96-3 C18H12NNaO6 361.28 sodium; (2E)-2-[2-(3,5-dihydroxy-4-oxocyclohexa-2,5-dien-1-ylidene)ethylidene]-8-hydroxy-1H-quinoline-7-carboxylate; 210890-96-3; CHEMBL329488; (E)-8-Hydroxy-2-[2-(3,4,5-trihydroxyphenyl)ethenyl]-7-quinolinecarboxylicacidsodiumsalt; AN-29912
(E)-7-Tetradecen-1-ol 37011-95-3 C14H28O 212.37152 (E)-7-Tetradecen-1-ol
(E)-7-Methyl-3-methyleneocta-4,6-dien-2-ol 22451-63-4 C10H16O
(E)-6-Nitro-3-[2-(pyridin-2-yl)ethenyl]-1-(tetrahydro-2H-pyran-2-yl)-1H-indazole 886230-75-7 C19H18N4O3 350.37
(E)-6,7-DIHYDROBENZOFURAN-4(5H)-ONE OXIME 61190-46-3 C8H9NO2 151.16 (E)-6,7-DIHYDROBENZOFURAN-4(5H)-ONE OXIME
(E)-6,7-DIHYDRO-1H-INDOL-4(5H)-ONE OXIME 27866-27-9 C8H10N2O 150.18 (E)-6,7-DIHYDRO-1H-INDOL-4(5H)-ONE OXIME
(E)-6,6-DIMETHYL-HEPT-2-EN-4-YNOIC ACID 54599-50-7 C9H12O2 152.19 (E)-6,6-DIMETHYL-HEPT-2-EN-4-YNOIC ACID
(E)-5-Methyl-2-styrylbenzoxazole 73916-05-9 C16H13NO 235.28052 (E)-5-Methyl-2-styrylbenzoxazole
(E)-5-Methyl-1-(2,6,6-trimethylcyclohex-2-en-1-yl)hex-1-en-3-one 99948-88-6 C16H26O
(E)-5-Isopropyl-8-methylnona-6,8-dien-2-one 54868-48-3 C13H22O
(E)-5-HYDROXY-7H-PYRIDO[2,3-B]AZEPIN-8(9H)-ONE 652976-28-8 C9H6N2O2 174.16 (E)-5-HYDROXY-7H-PYRIDO[2,3-B]AZEPIN-8(9H)-ONE
(E)-5-ETHOXYCARBONYLVINYL URACIL 55520-60-0 C9H10N2O4 210.1867 (E)-5-ETHOXYCARBONYLVINYL URACIL
(E)-4-Octenedioic acid 48059-97-8 C8H12O4 172.18 (E)-4-Octenedioic acid; E-oct-4-ene-1,8-dioic acid
(E)-4-methyl-2-(4-methyl-3-oxobenzo[b]thiophen-2(3H)-ylidene)benzo[b]thiophen-3(2H)-one 5858-24-2 C18H12O2S2 324.41668 (E)-4-methyl-2-(4-methyl-3-oxobenzo[b]thiophen-2(3H)-ylidene)benzo[b]thiophen-3(2H)-one
(E)-4-METHOXY-1-TRIMETHYLSILANYLOXY-BUT-3-EN-2-ONE 80127-63-5 C8H16O3Si 188.29634
(E)-4-ETHOXY-NONA-1,5-DIENE 67323-96-0 C11H20O 168.2759 (E)-4-ETHOXY-NONA-1,5-DIENE
(E)-4-[Bis(4-methylphenyl)amino]benzaldehyde 2,2-diphenylhydrazone 906674-39-3 C33H29N3 467.60 (E)-4-[Bis(4-methylphenyl)amino]benzaldehyde 2,2-diphenylhydrazone
(E)-4-[3-bromo-1-(4-nitrophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl 94732-95-3 C21H15BrClNO2 428.7063 (E)-4-[3-bromo-1-(4-nitrophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl; 4-[(E)-3-Bromo-1-(4-nitrophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl
(E)-4-[3-bromo-1-(4-chlorophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl 94732-96-4 C21H15BrCl2 418.1538 (E)-4-[3-bromo-1-(4-chlorophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl; 4-[(E)-3-Bromo-1-(4-chlorophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl
(E)-4-[3-bromo-1-(4-bromophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl 97338-00-6 C21H15Br2Cl 462.6048 (E)-4-[3-bromo-1-(4-bromophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl; 4-[(E)-3-Bromo-1-(4-bromophenyl)-1-propenyl]-4'-chloro-1,1'-biphenyl
(E)-4-[2-(3,4,5-trimethoxyphenyl)ethenyl]-Phenol 116519-00-7 C17H18O4 286.325 (E)-4'-Hydroxy-3,4,5-trimethoxystilbene; (E)-4-[2-(3,4,5-Trimethoxyphenyl)ethenyl]-phenol
(E)-4-[(benzyloxy)methyl]-2-(bromomethyl)-1,3-dioxolane 6204-41-7 C12H15BrO3 287.1497 (E)-4-[(benzyloxy)methyl]-2-(bromomethyl)-1,3-dioxolane; trans-2-(Bromomethyl)-4-[(phenylmethoxy)methyl]-1,3-dioxolane
(E)-4,4'-Ethylenebis(1,1'-biphenyl) 1657-71-2 C26H20 334.45288 (E)-4,4'-ethylenebis(1,1'-biphenyl); (E)-4,4'-Diphenylstilbene; (E)-p,p'-Diphenylstilbene; 4,4''-[(E)-1,2-Ethenediyl]bis[1,1'-biphenyl]
(E)-4,4'-Bis(diphenylamino)stilbene 202748-68-3 C38H30N2 514.66 (E)-4,4'-Bis(diphenylamino)stilbene; BDPAS; trans-4,4'-Bis(diphenylamino)stilbene
(E)-4,4,4-TRIFLUORO-1-PHENYL-BUT-2-EN-1-ONE 3108-34-7 C10H7F3O 200.16 4,4,4-TRIFLUORO-1-PHENYLBUT-2-(E)-ENE-1-ONE; (E)-4,4,4-TRIFLUORO-1-PHENYL-BUT-2-EN-1-ONE
(E)-4-(4-NITROPHENYL)-4-OXOBUT-2-ENOIC ACID 63104-97-2 C10H7NO5 221.17 (E)-4-(4-NITROPHENYL)-4-OXOBUT-2-ENOIC ACID
(E)-4-(4-Methoxystyryl)quinoline 31059-69-5 C18H15NO 261.3178 (E)-4-(4-Methoxystyryl)quinoline
(E)-4-(4-Hydroxystyryl)pyridine 67882-97-7 C13H11NO 197.23254 (E)-4-(4-Hydroxystyryl)pyridine
(E)-3-p-Tolyl-acrylic acid butyl ester 123248-21-5
(E)-3-methyl-2-phenyl-8-(prop-1-enyl)-4H-chromen-4-one 97070-55-8 C19H16O2 276.33
(E)-3-Iodo-2-buten-1-ol 37428-58-3 C4H7IO 198.00 (2E)-3-Iodo-2-buten-1-ol;
(E)-3-Dimethylamino-1-phenyl-propenone 1201-93-0 C11H13NO 175.23 (E)-3-Dimethylamino-1-phenyl-propenone; (E)-3-(Dimethylamino)-1-phenylprop-2-en-1-one
(E)-3-Dimethylamino-1-furan-2-yl-propenone 109482-86-2 C9H11NO2 165.18 3-DIMETHYLAMINO-1-FURAN-2-YL-PROPENONE; 3-(DIMETHYLAMINO)-1-(2-FURYL)-2-PROPEN-1-ONE; (2E)-3-(DIMETHYLAMINO)-1-(2-FURYL)PROP-2-EN-1-ONE; 3-(DIMETHYLAMINO)-1-(FURAN-2-YL)PROP-2-EN-1-ONE
(E)-3-cyclopentyl-2-(4-(methylsulfonyl)phenyl)prop-2-en-1-ol 731017-34-8 C15H20O3S 280.38300
(E)-3-Cyclohexylacrylic acid 56453-86-2 C9H14O2 154.21 (E)-3-Cyclohexylacrylic acid; (2E)-3-cyclohexylprop-2-enoic acid
(E)-3-Cyclohexyl-2-propen-1-ol 114096-03-6 C9H16O 140.22 (E)-3-Cyclohexyl-2-propen-1-ol
(E)-3-cyano-3-(methylimino)-2-oxopropanoic acid 38157-71-0 C3H2N2O3 140.10 (E)-3-CYANO-3-(METHYLIMINO)-2-OXOPROPANOIC ACID
(E)-3-carboxy-1,1-dimethyl-2-propenyl 117831-56-8 C6H9O2 113.13446;g/mol 4-methylpent-2-enoicacid; (E)-3-carboxy-1,1-dimethyl-2-propenyl; 117831-56-8
(E)-3-BENZYLIDENECHROMAN-4-ONE 30779-90-9 C16H12O2 236.27 3-[(E)-PHENYLMETHYLIDENE]-2,3-DIHYDRO-4H-CHROMEN-4-ONE; BUTTPARK 105\40-18; (E)-3-BENZYLIDENECHROMAN-4-ONE
(E)-3-BENZYLIDENE-6-CHLOROCHROMAN-4-ONE 206071-98-9 C16H11ClO2 270.71 (E)-3-BENZYLIDENE-6-CHLOROCHROMAN-4-ONE
(E)-3-[cyano(2,3-dichlorophenyl)methylene]carbazamidine 94213-24-8 C9H7Cl2N5
(E)-3-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-2-propenenitrile 256431-72-8 C21H15FN2 314.36 (E)-3-[2-CYCLOPROPYL-4-(4-FLUOROPHENYL)-3-QUINOLINYL]-2-PROPENENITRILE; (E)-3-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-2-propopenenitrile
(E)-3-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-2-propenal 148901-68-2 C21H16FNO 317.36 (E)-3-[2-Cyclopropyl-4-(4-fluorophenyl)-3-Quinolinyl-2-propenal; PT-4; (E)-3-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]prop-2-en-1-al; (E)-3''-[4-(4''-FLUOROPHENYL)-2-(CYCLOPROPYL)-3-QUINOLINYL]-2-PROPENAL
(E)-3,7-Dimethyl-2,6-octadienenitrile 5585-39-7 C10H15N 149.23 (E)-3,7-Dimethyl-2,6-octadienenitrile; Geranitrile
(E)-3,6-DIMETHYL-HEPTA-2,5-DIENAL 96839-90-6 C9H14O 138.20686 (E)-3,6-DIMETHYL-HEPTA-2,5-DIENAL
(E)-3,3,3-Trifluoro-1-propenyl benzyl ether 932395-40-9 C10H9F3O 202.1731
(E)-3-(Methoxycarbonyl)-4-(5-methylfuran-2-yl)but-3-enoic acid 37978-59-9 C11H12O5 224.20998;g/mol (E)-3-methoxycarbonyl-4-(5-methylfuran-2-yl)but-3-enoicacid;(E)-3-(METHOXYCARBONYL)-4-(5-METHYLFURAN-2-YL)BUT-3-ENOICACID;37978-59-9;PubChem22799;SCHEMBL2655368;SCHEMBL2655373
(E)-3-(Dimethylamino)-2-methoxyacrylaldehyde 13616-34-7 C6H11NO2 129.16 (E)-3-(Dimethylamino)-2-methoxyacrylaldehyde; 3-(Dimethylamino)-2-methoxyacrylaldehyde
(E)-3-(dimethylamino)-1-(pyridin-4-yl)prop-2-en-1-one 66521-53-7 C10H12N2O 176.22 3-(DIMETHYLAMINO)-1-(4-PYRIDINYL)-2-PROPEN-1-ONE; 3-DIMETHYLAMINO-1-PYRIDIN-4-YL-PROPENONE; (E)-3-(Dimethylamino)-1-(Pyridin-4-Yl)Prop-2-En-1-One; (E)-3-DIMETHYLAMINO-1-PYRIDIN-4-YL-PROPENONE
(E)-3-(DIETHYLAMINO)-1-(2-HYDROXY-5-METHYLPHENYL)PROP-2-EN-1-ONE 213689-90-8 C14H19NO2 233.31 (E)-3-(DIETHYLAMINO)-1-(2-HYDROXY-5-METHYLPHENYL)PROP-2-EN-1-ONE
(E)-3-(4-METHOXY-PHENYL)-BUT-2-ENOIC ACID ETHYL ESTER 7706-82-3 C13H16O3 220.26434 (E)-3-(4-METHOXY-PHENYL)-BUT-2-ENOIC ACID ETHYL ESTER; ethyl 3-(4-methoxyphenyl)-2-butenoate; 3-(4-Methoxyphenyl)-2-butenoic acid ethyl ester
(E)-3-(4'-bromo[1,1'-biphenyl]-4-yl)-3-(4-chlorophenyl)-N,N-dimethylallylamine hydrochloride 97392-66-0 C23H22BrCl2N 463.23748 (E)-3-(4'-bromo[1,1'-biphenyl]-4-yl)-3-(4-chlorophenyl)-N,N-dimethylallylamine hydrochloride
(E)-3-(3,4-DIMETHOXYPHENYL)-1-(3-HYDROXYPHENYL)-1-PROPENONE 178445-80-2 C17H16O4 284.31 (E)-3-(3,4-DIMETHOXYPHENYL)-1-(3-HYDROXYPHENYL)-1-PROPENONE; (E)-3-(3,4-Dimethoxyphenyl)-1-(3-hydroxyphenyl)prop-2-en-1-one
(E)-3-(2-Formylphenyl)-2-propenoic acid 1,1-dimethyl ethyl ester 103890-69-3 C14H16O3 232.28 (E)-3-(2-FORMYIPHENYL)-2-PROPENOIC ACID 1,1-DIMETHYL ETHYL ESTER; (e)-3-(2-formylphenyl)-2-propenoic acid 1,1-dimethyl ethyl ester; (E)-3-(2-Formylphenyl)-2-Prope; (E)-3-(2-FORMYLPHENYL)-2-PROPENOIC ACID 1,1-DIMETHYL ETHYL ESTER,80+%
(E)-3-(2,4-dimethoxyphenyl)but-2-enoic acid 7706-67-4 C12H14O4 222.24 Dimecrotic acid; Dimecrotic; (E)-3-(2,4-Dimethoxyphenyl)but-2-enoic acid; 2,4-Dimethoxy-beta-methylcinnamic acid; 3-(2,4-Dimethoxyphenyl)-2-butenoic acid; 3-(2,4-Dimethoxyphenyl)-3-methylpropenoic acid
(E)-3-(2-(pyridin-2-yl)vinyl)-1-(tetrahydro-2H-pyran-2-yl)-1H-indazol-6-amine 886230-76-8 C19H20N4O 320.39
(E)-2-Pyrimidinecarboxaldehyde oxime 39232-40-1 C5H5N3O 123.11 2-(nitrosomethylidene)-1H-pyrimidine; (E)-Pyrimidine-2-carbaldehydeoxime; 39232-40-1; 2-PYRIMIDINECARBOXALDEHYDE,OXIME; (E)-2-Pyrimidinecarboxaldehydeoxime; 2pco
(E)-2-propylhept-2-en-1-ol 94291-82-4 C10H20O 156.2652
(E)-2-Oxo-4-phenylbut-3-enenitrile 60299-77-6 C10H7NO 0 (E)-2-Oxo-4-phenylbut-3-enenitrile
(E)-2-methyloct-6-en-2-ol 93919-12-1 C9H18O
(E)-2-Methylhex-3-ene 692-24-0 C7H14 98.19 (3E)-2-Methyl-3-hexene; (E)-2-Methyl-3-hexene; (E)-3-Hexene, 2-methyl; 2-Methyl-trans-3-hexene; TRANS-3-METHYL-3-HEXENE; (E)-2-methylhex-3-ene
(E)-2-Methylhept-3-ene 692-96-6 C8H16 112.22
(E)-2-methyl-2-butenenitrile 30574-97-1 C5H7N 81.11578 (E)-2-Methyl-2-butenenitrile; 2-METHYL-2-BUTENENITRILE; Tiglonitrile; alpha-Methylcrotononitrile; 2,3-Dimethylacrylonitrile; 30574-97-1
(E)-2-methoxy-4-prop-1-enylphenyl isobutyrate 84604-51-3 C14H18O3
(E)-2-hexenyl octanoate 85554-72-9 C14H26O2 226.35504 (E)-2-hexenyl octanoate; 2-HEXENYLOCTANOATE; TRANS-2-HEXENYL OCTANOATE; Octanoic acid (E)-2-hexenyl ester; Einecs 287-605-5; Octanoic acid, 2-hexenyl ester, (E)-
(E)-2-Hexen-1-ol formate 53398-78-0 C7H12O2 128.17 TRANS-2-HEXENYL FORMATE; FEMA 3927; (E)-hex-2-enyl formate; (E)-2-Hexen-1-olformate; 2-Hexen-1-ol, formate, (2E)-; 2-HEXENYLFORMATE
(E)-2-Decen-4-yn-1-ol 16195-87-2 C10H16O
(E)-2-CYANO-5-METHYL-HEX-2-ENOIC ACID METHYL ESTER 96914-67-9 C9H13NO2 167.20502 (E)-2-CYANO-5-METHYL-HEX-2-ENOIC ACID METHYL ESTER
(E)-2-Cyano-3-(3,4-dihydroxyphenyl)-2-propenoic acid 122520-79-0 C10H7NO4 205.17 (E)-2-Cyano-3-(3,4-dihydroxyphenyl)-2-propenoic acid; Tyrphostin AG 30
(E)-2-Bromo-4,4,4-trifluoro-2-butenoic acid ethyl ester 138778-57-1 C6H6BrF3O2 247.01 (E)-2-Bromo-4,4,4-trifluoro-2-butenoic acid ethyl ester
(E)-2-Bromo-2-butenenitrile 24325-95-9 C4H4BrN
(E)-2,6-dichlorobenzoyl chloride oxime 35623-69-9 C7H4Cl3NO
(E)-2,5-dichloro-2,5-dimethyl-hex-3-ene 22966-70-7 C8H14Cl2 181.10276;g/mol trans-2,5-Dichloror-2,5-dimethyl-3-hexene;22966-70-7;(E)-2,5-Dichloro-2,5-dimethyl-hex-3-ene;AC1NUX6W;(E)-2,5-DICHLORO-2,5-DIMETHYL-HEX-3-ENE;OR045753
(E)-2,2'-Vinylenebis[5-methylbenzoxazole] 17233-65-7 C18H14N2O2 290.31596 (E)-2,2'-vinylenebis[5-methylbenzoxazole]; 2'-(1,2-ethenediyl)bis(5-methyl- (e)-benzoxazol; 2,2'-(1,2-ethenediyl)bis[5-methyl-, (E)-Benzoxazole; trans-2,2'-Ethylenebis(5-methylbenzoxazole); 2,2'-[(E)-1,2-Ethenediyl]bis(5-methylbenzoxazole)
(E)-2-(4-tert-butylphenyl)-2-cyano-1-(1,3,4-trimethylpyrazol-5-yl)vinyl 2,2-dimethylpropionate 560121-52-0
(E)-2-(4-Phenylstyryl)-5-methylbenzoxazole 2492-03-7 0 (E)-2-(4-PHENYLSTYRYL)-5-METHYLBENZOXAZO
(E)-2-(4-Chlorostyryl)-5-methylbenzoxazole 2639-35-2 C16H12ClNO 269.72558 (E)-2-(4-Chlorostyryl)-5-methylbenzoxazole; (E)-2-(4-CHLOROSTYRYL)-5-METHYL BENZOXAZ
(E)-2-(3-hexenyloxy)-1,3-dioxolane 93919-13-2 C9H16O3 172.22154 (E)-2-(3-hexenyloxy)-1,3-dioxolane; 2-[[(E)-3-Hexenyl]oxy]-1,3-dioxolane
(E)-2-(2-HYDROXYSTYRYL)PYRIDINE 19087-55-9 C13H11NO 197.2325
(E)-1-STYRYLCYCLOPROPANAMINE 604799-99-7 C11H13N 159.23 (E)-1-STYRYLCYCLOPROPANAMINE
(E)-1-PHENYL-HEPT-3-EN-1-ONE 53403-90-0 C13H16O 188.26554
(E)-1-PHENYL-3-(2-THIENYL)-2-PROPEN-1-ONE 2910-81-8 C13H10OS 214.28 (E)-1-PHENYL-3-(2-THIENYL)-2-PROPEN-1-ONE; 1-PHENYL-3-(2-THIENYL)PROP-2-EN-1-ONE; RARECHEM AM UC 0309; [3-(2-Thienyl)acryloyl]benzene; 1-Phenyl-3-(2-thienyl)-2-propen-1-one; 2-(2-Thienyl)ethenylphenyl ketone
(E)-1-Pentene-1,2-diboronic acid bis(pinacol) ester 307531-75-5 322.06 1-[cis-1,2-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)] pentene, 2,2-[(1Z)-1-Propyl-1,2-ethenediyl]bis[4,4,5,5-tetramethyl-1,3,2-dioxaborolane]
(E)-1,4-BIS(4-METHYLPHENYL)-2-BUTENE-1,4-DIONE 17342-09-5 C18H16O2 264.32 (E)-1,4-BIS(4-METHYLPHENYL)-2-BUTENE-1,4-DIONE; (E)-1,2-Bis(4-methylbenzoyl)ethene; trans-1,4-Di(p-tolyl)-2-buten-1,4-dione
(E)-1,4-BIS(-4-BROMOSTYRYL)BENZENE 58358-55-7 C22H16Br2 0 (E)-1,4-BIS(-4-BROMOSTYRYL)BENZENE
(E)-1,3-dimethoxy-5-(4-nitrostyryl)benzene 586410-18-6 C16H15NO4 285.2946;g/mol CHEMBL210300;586410-18-6;SCHEMBL3392246;MolPort-035-783-535;BDBM50185134;ZINC34258611
(E)-1-(PROP-1-ENYL)CYCLOPROPANAMINE 885268-15-5 C6H11N 97.16 (E)-1-(PROP-1-ENYL)CYCLOPROPANAMINE; 1-(PROP-1-ENYL)CYCLOPROPANAMINE
(E)-1-(5-CHLORO-2-HYDROXYPHENYL)-3-(DIETHYLAMINO)PROP-2-EN-1-ONE 213689-95-3 C13H16ClNO2 253.72 (E)-1-(5-CHLORO-2-HYDROXYPHENYL)-3-(DIETHYLAMINO)PROP-2-EN-1-ONE
(E)-1-(5-CHLORO-2-HYDROXY-4-METHYLPHENYL)-3-(DIETHYLAMINO)PROP-2-EN-1-ONE 213690-07-4 C14H18ClNO2 267.75 (E)-1-(5-CHLORO-2-HYDROXY-4-METHYLPHENYL)-3-(DIETHYLAMINO)PROP-2-EN-1-ONE
(E)-1-(4-HYDROXYPHENYL)-1-[4-(TRIMETHYLACETOXY)PHENYL]-2-PHENYLBUT-1-ENE 177748-17-3 C27H28O3 400.51 (E)-1-(4-HYDROXYPHENYL)-1-[4-(TRIMETHYLACETOXY)PHENYL]-2-PHENYLBUT-1-ENE
(E)-1-(2-bromovinyl)-4-methylbenzene 60655-80-3 C9H9Br 197.07200
(E)-1-(2-bromovinyl)-3-chlorobenzene 76557-95-4
(E)-1-(2-bromovinyl)-3-chlorobenzene 115665-71-9
(E)-1-(2-bromovinyl)-2-methylbenzene 394698-73-8
(E)-1-(2-bromovinyl)-2-methoxybenzene 203176-36-7 C9H9BrO 213.07100
(E)-1-(2-bromovinyl)-2-fluorobenzen 187463-12-3 C23H28N4O8S 520.55542;g/mol Vaneprim; 81523-49-1; Vaneprimum; Vaneprim[INN]; AC1L50E9; SCHEMBL2109712
(E)-1-(2-bromovinyl)-2-fluorobenzen 291530-89-7
(E)-1-(2-bromovinyl)-2-chlorobenzene 59503-00-3
(E)-1-(2-(methylthio)pyrimidin-4-yl)ethanone oxime 521092-43-4 C7H9N3OS
(E)-1-(2-(FURAN-2-YL)VINYL)CYCLOPROPANAMINE 604800-01-3 C9H11NO 149.19 (E)-1-(2-(FURAN-2-YL)VINYL)CYCLOPROPANAMINE; Cyclopropanamine, 1-[(1E)-2-(2-furanyl)ethenyl]- (9CI)
(E)-1-(1-PHENYLPROP-1-EN-2-YL)CYCLOPROPANAMINE 604800-02-4 C12H15N 173.25 (E)-1-(1-PHENYLPROP-1-EN-2-YL)CYCLOPROPANAMINE
(E)-1-((3-Pentyl-1H-inden-1-ylidene)methyl)naphthalene 619294-62-1 C25H24 0 (E)-1-((3-Pentyl-1H-inden-1-ylidene)methyl)naphthalene
(E)-[(3,7-dimethyl-2,6-octadienyl)oxy]acetaldehyde 65405-73-4 C12H20O2 196.286 (E)-[(3,7-dimethyl-2,6-octadienyl)oxy]acetaldehyde; Acetaldehyde, (2E)-3,7-dimethyl-2,6-octadienyloxy-; (E)-[(3,7-Dimethyl-2,6-octadienyl)oxy]acetaldehyd; [(3,7-dimethyl-2,6-octadienyl) oxy]-, (E)-Acetaldehyde; [[(2E)-3,7-Dimethyl-2,6-octadienyl]oxy]aceta
(E)-(4-(Trifluoromethoxy)benzylidene)hydrazine 1138566-90-1
(E)-(-)-octahydrocyclopenta(b)pyrrole-2-carboxylic acid hydrochloride 87269-86-1 C8H13NO2.HCl 191.66
(E)&(Z)-4,8-DIMETHYL-3,7-NONADIEN-2-ONE 817-88-9 C11H18 O
(E) -4'-hydroxy-3,5,3'-Trimethoxystilbene 108957-72-8 C17H18O4 0 4-[(E)-2-(3,5-Dimethoxyphenyl)ethenyl]-2-methoxyphenol; (E)-4'-Hydroxy-3,5,3'-trimethoxystilbene
(E) -3'-hydroxy-3,5,4'-Trimethoxystilbene 108957-73-9 C17H18O4 0 5-[(E)-2-(3,5-dimethoxyphenyl)ethenyl]-2-methoxy-phenol; 4,3',5'-tri-O-methylpiceatannol; (E)-3'-Hydroxy-3,5,4'-trimethoxystilbene
(D-Val22)-Big Endothelin-1 fragment (16-38) (human) 158884-64-1 C119H180N32O33 2586.9 [DVAL22] BIG ENDOTHELIN-1 (16-38), HUMAN; [D-VAL22]-BIG ENDOTHELIN (16-38) (HUMAN); (D-VAL22)-BIG ENDOTHELIN-1 FRAGMENT (16-38) (HUMAN); (D-VAL22)-BIG ET-1 (16-38) (HUMAN); H-HIS-LEU-ASP-ILE-ILE-TRP-D-VAL-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SE
(D-TYR4)-MTII 213314-49-9 C65H87N17O17 1378.49 AC-NLE-CYCLO(-ASP-HIS-D-TYR-ARG-TRP-LYS-NH2); AC-NLE-C(-ASP-HIS-DTYR-ARG-TRP-LYS-NH2); ACETYL-(NLE4,ASP5,DTYR7,LYS10)-CYCLO-ALPHA MELANOCYTE STIMULATING HORMONE (4-10) AMIDE; ACETYL-(NLE4,ASP5,D-TYR7,LYS10)-CYCLO-ALPHA-MSH (4-10) AMIDE; (D-TYR4)-MTII; Ace
(D-TYR1,N-ME-PHE3)-NEUROPEPTIDE FF 145274-93-7 0 (D-TYR1,N-ME-PHE3)-NEUROPEPTIDE FF; DME; H-D-TYR-LEU-N-ME-PHE-GLN-PRO-GLN-ARG-PHE-NH2
(D-Pro2,D-Trp6,8,Nle10)-Neurokinin B 109212-72-8 C67H87N15O14 1326.5 ASP-D-PRO-HIS-ASP-PHE-D-TRP-VAL-D-TRP-LEU-NLE-NH2; (D-PRO2,D-TRP6,8,NLE10)-NEUROKININ B; DPHDFWVWL-NLE-NH2; H-ASP-D-PRO-HIS-ASP-PHE-D-TRP-VAL-D-TRP-LEU-NLE-NH2
(D-Phe6,Leu-NHEt13,des-Met14)-Bombesin (6-14) 124199-90-2 C49H69N13O9 984.15 D-PHE-GLN-TRP-ALA-VAL-GLY-HIS-LEU-NHET; (D-PHE6,LEU-NHET13,DES-MET14)-BOMBESIN (6-14); H-D-PHE-GLN-TRP-ALA-VAL-GLY-HIS-LEU-NHET
(D-PHE12,NLE21,38)-CRF (12-41) (HUMAN, RAT) 129133-27-3 C158H265N49O43 3539.1 (D-PHE12,NLE21,38)-CORTICOTROPIN-RELEASING FACTOR (12-41) (HUMAN, RAT); (DPHE12,NLE21'38)-CORTICOTROPIN RELEASING FACTOR (12-41), HUMAN, RAT; (D-PHE12,NLE21,38)-CRF (12-41) (HUMAN, RAT); (DPHE12,NLE21'38)-CRF (12-41), HUMAN, RAT; H-D-PHE-HIS-LEU-LEU-ARG-G
(D-PEN2,P-CHLORO-PHE4,D-PEN5)-ENKEPHALIN 122507-47-5 C30H38ClN5O7S2 680.24 (D-PEN2,P-CHLORO-PHE4,D-PEN5)-ENKEPHALIN; (D-PEN2,5, P-CL-PHE4)-ENKEPHALIN; H-TYR-D-PEN-GLY-P-CHLORO-PHE-D-PEN-OH; TYR-D-PEN-GLY-P-CHLORO-PHE-D-PEN; TYR-D-PEN-GLY-PCL-PHE-D-PEN; pen(2,5)-4-chloro-phe(4)-enkephali
(Dodecylmethylbenzyl)trimethylammonium chloride 28855-27-8 C23H42ClN 368.03928 (dodecylmethylbenzyl)trimethylammonium chloride
(Dodecylbenzyl)trimethylammonium chloride 1330-85-4 C22H40ClN 354.01 (DODECYLBENZYL)TRIMETHYLAMMONIUM CHLORIDE; ar-dodecyl-n,n,n-trimethyl-benzenemethanaminiuchloride; quaternium-28; Benzenemethaminium, ar-dodecyl-N,N,N-trimethyl, chloride; DODECYLBENZYLTRIMONIUM CHLORIDE; (Dodecylbenzyl)trimethylammoniumchloridetech; TRIM
(dodecylbenzyl)triethylammonium chloride 28679-24-5 C25H46ClN 396.09244 (dodecylbenzyl)triethylammonium chloride
(Dodecylbenzyl)dimethyl[2-[(1-oxooctadecyl)oxy]ethyl]ammonium chloride 93982-15-1 C41H76ClNO2 650.50064 (dodecylbenzyl)dimethyl[2-[(1-oxooctadecyl)oxy]ethyl]ammonium chloride
(D-Trp8)-Somatostatin-14 58976-46-8 C76H104N18O19S2 1637.88 (D-Trp8)-Somatostatin-14; [D-Trp8]-Somatostatin
(D-Trp6)-LHRH (free acid) 129418-54-8 C64H81N17O14 0 (D-TRP6)-LHRH (FREE ACID); PYR-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-GLY-OH; TRIPTORELIN (FREE ACID)
(D-Trp32)-Neuropeptide Y (porcine) 153549-78-1 C197H290N56O56 0 YPSKPDNPGEDAPAEDMARYYSALRHYINLIWRQRY-NH2; TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-D-TRP-ARG-GLN-ARG-TYR-NH2; H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-
(D-Trp32)-Neuropeptide Y (human, rat) 178861-83-1 C196H288N56O56S 0 YPSKPDNPGEDAPAEDMARYYSALRHYINLIWRQRY-NH2; TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-D-TRP-ARG-GLN-ARG-TYR-NH2; (D-TRP32)-NEUROPEPTIDE Y (HUMAN, RAT); [DTRP32]NEUROPEPTIDE Y
(D-TRP2,7,9)-SUBSTANCE P 100930-11-8 C80H109N21O13S 1604.92 (D-TRP2,7,9)-SUBSTANCE P; H-ARG-D-TRP-LYS-PRO-GLN-GLN-D-TRP-PHE-D-TRP-LEU-MET-NH2; ARG-D-TRP-LYS-PRO-GLN-GLN-D-TRP-PHE-D-TRP-LEU-MET-NH2
(D-TRP2)-METHIONINE ENKEPHALINAMIDE*ACET ATE 73459-29-7
(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) 118102-98-0 C165H251N49O40S2 0 H-PHE-MET-HIS-ASN-LEU-D-TRP-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-TYR-NH2; (D-TRP12,TYR34)-PTH (7-34) AMIDE (BOVINE); THYROID, BOVINE; H-Phe-Met-His-Asn-Leu-D-Trp-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Le
(D-Trp11)-Neurotensin 100929-52-0 C80H122N22O19 1695.98 neurotensin [D-Trp11]
(DTBM)2P(O)H 535925-40-7 C30H47O3P 486.67 BIS(3,5-DI-TERT-BUTYL-4-METHOXYPHENYL)PHOSPHINE OXIDE; (DTBM)2P(O)H
(D-Ser4,D-Trp6)-LHRH 102992-39-2 C64H82N18O13 1311.45 PYR-HIS-TRP-D-SER-TYR-D-TRP-LEU-ARG-PRO-GLY-NH2; (D-SER4)-TRIPTORELIN; (D-SER4,D-TRP6)-GONADOTROPIN-RELEASING HORMONE; (D-SER4,D-TRP6)-LHRH; (D-SER4,D-TRP6)-LUTEINIZING HORMONE-RELEASING FACTOR; (D-SER4,D-TRP6)-LUTEINIZING HORMONE-RELEASING HORMONE; [D-TR
(D-gluconato-O1)(D-glycero-D-gulo-heptonato-O1)calcium 95873-61-3 C13H24CaO15 0 (D-gluconato-O1)(D-glycero-D-gulo-heptonato-O1)calcium; [(D-Glucos-1-yl)oxy][(D-glycero-D-gulo-heptos-1-yl)oxy]calcium salt
(D-Glu5,D-Trp7,9,10)-Substance P (5-11) 289632-61-7 C57H66N12O10S 1111.27 H-D-GLU-GLN-D-TRP-PHE-D-TRP-D-TRP-MET-NH2; (D-GLU5,D-TRP7,9,10)-SUBSTANCE P (5-11)
(DES-TYR1)-LEU-ENKEPHALIN 60254-83-3 C19H28N4O5 392.45 des-tyr(1)-enkephalin-le; ENKEPHALIN (DES TYR2, LEU4); [DES-TYR1,LEU5]-ENKEPHALIN; (DES-TYR1)-LEU-ENKEPHALIN; GLY-GLY-PHE-LEU; H-GLY-GLY-PHE-LEU-OH; enkephalin-Leu, des-Tyr(1)-
(DES-PYR1)-LHRH 38280-53-4 C50H70N16O11 1071.19 DES-PGLU1-LH-RH; (DES-PYR1)-GONADOTROPIN-RELEASING HORMONE; (DES-PYR1)-LHRH; (DES-PYR1)-LUTEINIZING HORMONE-RELEASING FACTOR; (DES-PYR1)-LUTEINIZING HORMONE-RELEASING HORMONE; HIS-TRP-SER-TYR-GLY-LEU-ARG-PRO-GLY-NH2; H-HIS-TRP-SER-TYR-GLY-LEU-ARG-PRO-GLY-
(a,S)-2-Chloro-a-{[2-(2-thienyl)-ethyl]-amino}-benzeneacetic acid (1S,4R)-7,7-dimethyl-2-oxobicyclo[2.2.1]heptane-1-methanesulfonate methyl ester 141109-21-9 C25H32ClNO6S2 542.10768;g/mol [(1R,4S)-7,7-dimethyl-3-oxo-4-bicyclo[2.2.1]heptanyl]methanesulfonicacid;methyl2-(2-chlorophenyl)-2-(2-thiophen-2-ylethylamino)acetate;(a,S)-2-Chloro-a-{[2-(2-thienyl)-ethyl]-amino}-benzeneaceticacid(1S,4R)-7,7-dimethyl-2-oxobicyclo[2.2.1]heptane-1-methan
(ACRYLOXYPROPYL)METHYLSILOXANE-DIMETHYLSILOXANE COPOLYMER 158061-40-6 0 (ACRYLOXYPROPYL)METHYLSILOXANE-DIMETHYLSILOXANE COPOLYMER; (ACRYLOXYPROPYL)METHYLSILOXANE-DIMETHYLSILOXANE COPOLYMER, VISCOSITY 80-120 CST.; [15-20% (ACRYLOXYPROPYL)METHYLSILOXANE] - DIMETHYLSILOXANE COPOLYMER, 80-120cs; Siloxanes and silicones, di-me, me
(-Desmethyl-Rolipram 150519-28-1 C15H19NO3 0 2-Pyrrolidinone, 4-[3-(cyclopentyloxy)-4-hydroxyphenyl]-; (R,S)-Desmethyl-Rolipram
(Des-Gly10,D-Tyr5,D-Leu6,Pro-NHEt9)-LHRH 112710-57-3 C59H84N16O12
(3-HYDROXYPHENYL)-1,2,3,4,4A,5,12,12AA-OCTAHYDROQUINOLINO[2,3,3-G]ISOQUINOLINE DIHYDROBROMIDE 148545-09-9 C23H26Br2N2O 506.27 TAN-67 DIHYDROBROMIDE; SB 205607 DIHYDROBROMIDE; (3-HYDROXYPHENYL)-1,2,3,4,4A,5,12,12AA-OCTAHYDROQUINOLINO[2,3,3-G]ISOQUINOLINE DIHYDROBROMIDE; 2-METHYL-4AA-(3-HYDROXYPHENYL)-1,2,3,4,4A,5,12,12AA-OCTAHYDROQUINOLINO[2,3,3-G]ISOQUINOLINE DIHYDROBROMIDE; TAN
(3-Hydroxymethyl-pyridin-2-yl)-carbamic acid tert-butyl ester 877593-11-8 C11H16N2O3 224.26 TERT-BUTYL 3-(HYDROXYMETHYL)PYRIDIN-2-YLCARBAMATE; (3-HYDROXYMETHYL-PYRIDIN-2-YL)-CARBAMIC ACID TERT-BUTYL ESTER
(3aS,6aR)-Tetrahydro-4-methoxyfuro[3,4-b]furan-2(3H)-one 501921-30-8 C7H10O4 158.15 (3AS,6AR)-TETRAHYDRO-4-METHOXYFURO[3,4-B]FURAN-2(3H)-ONE; Tetrahydro-4-methoxy-(3aS,6aR)-Furo[3,4-b]furan-2(3H)-one
(4-PHENOXY-BENZYL)-HYDRAZINE 887594-18-5 C13H14N2O 214.26 (4-PHENOXY-BENZYL)-HYDRAZINE
(4-NITRO-PYRAZOL-1-YL)-ACETIC ACID 6645-69-8 C5H5N3O4 171.11 TIMTEC-BB SBB000166; ART-CHEM-BB B000219; CHEMBRDG-BB 5913009; (4-NITRO-PYRAZOL-1-YL)-ACETIC ACID; (4-NITRO-1H-PYRAZOL-1-YL)ACETIC ACID; AKOS B000219; AKOS PAO-0916; 2-(4-NITRO-1H-PYRAZOL-1-YL)ACETIC ACID
(4-NITRO-PHENYL)-PROPYNOIC ACID ETHYL ESTER 35283-08-0 C11H9NO4 219.19 (4-NITRO-PHENYL)-PROPYNOIC ACID ETHYL ESTER; Ethyl4-nitrophenylpropiolate
(4-nitrophenyl)methyl carbamimidothioate hydrochloride 4357-96-4 C8H10ClN3O2S 247.702 g/mol
(4-nitro-phenyl)-di-p-tolyl-amine 20440-92-0 C20H18N2O2 318.37 (4-Nitrophenyl)-di-p-tolylamine; 4-Nitro-N,N-bis(4-methylphenyl)benzenamine
(4-NITRO-PHENYL)-ACETYL CHLORIDE 769907-38-2 C8H6ClNO3 199.59 (4-NITRO-PHENYL)-ACETYL CHLORIDE
(4-NITROPHENYL)ACETONE OXIME 80605-38-5 C9H10N2O3 194.19 (4-NITROPHENYL)ACETONE OXIME; 2-PROPANONE, 1-(4-NITROPHENYL)-, OXIME
(3-PhenylaminoCarbonylphenyl)boronic acid 397843-71-9 C13H12BNO3 241.05 (3-PHENYLAMINOCARBONYLPHENYL)BORONIC ACID
(3-Phenyl-allyl)-phosphonic acid diethyl ester 58922-31-9 C13H19O3P 0 (3-PHENYL-ALLYL)-PHOSPHONIC ACID DIETHYL ESTER
(3-PHENYL-5-THIOXO-1,5-DIHYDRO-[1,2,4]TRIAZOL-4-YL)-ACETIC ACID 185034-18-8 C10H9N3O2S 235.26 (3-PHENYL-5-THIOXO-1,5-DIHYDRO-[1,2,4]TRIAZOL-4-YL)-ACETIC ACID
(3-Phenyl-5-isoxazolyl)methanamine 54408-35-4 C10H10N2O 174.2 C-(3-PHENYL-ISOXAZOL-5-YL)-METHYLAMINE; 3-PHENYL-ISOXAZOL-5-YL-METHYLAMINE; (3-PHENYL-5-ISOXAZOLYL)METHANAMINE; 5-(Aminomethyl)-3-phenylisoxazole 97%; 5-(Aminomethyl)-3-phenylisoxazole; (3-phenylisoxazol-5-yl)methanamine
(3-PHENYL-2-PROPEN-1-YL)PROPYLAMINE 95% 869941-93-5 175.2733
(3-PHENYL-1-P-TOLYL-1H-PYRAZOL-4-YL)METHANOL 618441-58-0 C17H16N2O 264.32 (3-PHENYL-1-P-TOLYL-1H-PYRAZOL-4-YL)METHANOL; SALOR-INT L446041-1EA; (1-(4-METHYLPHENYL)-3-PHENYL-1H-PYRAZOL-4-YL)METHANOL
(3-PHENYL-1-O-TOLYL-1H-PYRAZOL-4-YL)METHANOL 618441-80-8 C17H16N2O 264.32 (3-PHENYL-1-O-TOLYL-1H-PYRAZOL-4-YL)METHANOL; SALOR-INT L446335-1EA; (1-(2-METHYLPHENYL)-3-PHENYL-1H-PYRAZOL-4-YL)METHANOL
(3-PHENYL-1-M-TOLYL-1H-PYRAZOL-4-YL)METHANOL 618441-86-4 C17H16N2O 264.32 SALOR-INT L446408-1EA; (3-PHENYL-1-M-TOLYL-1H-PYRAZOL-4-YL)METHANOL; (1-(3-METHYLPHENYL)-3-PHENYL-1H-PYRAZOL-4-YL)METHANOL
(3-Phenyl-1H-inden-1-ylidene)bis(tricyclohexylphosphine)ruthenium(IV) dichloride tetrahydrofuran adduct 250220-36-1 2C18H33P.C15H10Cl2Ru 923.07 (3-Phenyl-1H-inden-1-ylidene)bis(tricyclohexylphosphine)ruthenium(IV) dichloride tetrahydrofuran adduct; bis-(Tricyclohexylphoshine)-3-phenyl-1H-inden-1-ylideneruthenium(IV)dichloride)
(3-PHENYL-1,2,4-THIADIAZOL-5-YL)-HYDRAZINE 38379-75-8 C8H8N4S 192.24 (3-PHENYL-1,2,4-THIADIAZOL-5-YL)-HYDRAZINE
(3-phenyl-1,2,4-oxadiazol-5-yl)urea 5421-95-4 C9H8N4O2 204.185 g/mol
(3-Phenyl-1,2,4-oxadiazol-5-yl)methylamine 90564-77-5 C9H9N3O 175.19 METHYL-(3-PHENYL-[1,2,4]OXADIAZOL-5-YL)-AMINE; ASINEX-REAG BAS 08768035; CBI-BB ZERO/004833; C-(3-PHENYL-[1,2,4]OXADIAZOL-5-YL)-METHYLAMINE; AKOS BB-7187; (3-Phenyl-1,2,4-oxadiazol-5-yl)methylamine
(3-phenoxyphenyl)methyl (1S,3R)-3-(2,2-dichloroethenyl)-2,2-dimethyl-c yclopropane-1-carboxylate 51877-74-8 C21H20Cl2O3 0 (3-phenoxyphenyl)methyl (1S,3R)-3-(2,2-dichloroethenyl)-2,2-dimethyl-c yclopropane-1-carboxylate; (1R,3S)-3-(2,2-Dichlorovinyl)-2,2-dimethylcyclopropanecarboxylic acid (3-phenoxyphenyl)methyl ester; (1R,3S)-3-(2,2-Dichlorovinyl)-2,2-dimethylcyclopropaneca
(3-PHENOXY-PHENYL)-HYDRAZINE 104997-24-2 C12H12N2O 200.24 (3-PHENOXY-PHENYL)-HYDRAZINE
(3-PHENOXYPHENYL)ACETALDEHYDE 109330-01-0 C14H12O2 0 (3-PHENOXYPHENYL)ACETALDEHYDE; (4-Phenoxyphenyl)acetaldehyde
(3-OXO-PYRROLIDIN-1-YL)-ACETIC ACID 885277-96-3 C6H9NO3 143.14 (3-OXO-PYRROLIDIN-1-YL)-ACETIC ACID
(3-OXO-BUTYRYL)-CARBAMIC ACID ETHYL ESTER 7190-58-1 C7H11NO4 0
(3-OXO-3,4-DIHYDRO-2H-QUINOXALIN-1-YL)-ACETIC ACID 80310-02-7 C10H10N2O3 0
(3-OXO-1,3-DIHYDRO-ISOBENZOFURAN-1-YL)-ACETONITRILE 18327-98-5 C10H7NO2 173.16808 (3-OXO-1,3-DIHYDRO-ISOBENZOFURAN-1-YL)-ACETONITRILE
(2R,5R)-L-Menthyl-5-(acetyloxy)-1,3-oxathiolane-2-carboxylate 147027-09-6 C16H26O5S 330.44 (2R,5R)-
(2R,5R)-1-benzyl-2,5-dimethylpiperazine dihydrochloride 324750-43-8 C13H20N2 204.3113 (2R,5R)-1-Benzyl-2,5-Dimethyl-Piperazine; PIPERAZINE, 2,5-DIMETHYL-1-(PHENYLMETHYL)-, (2R,5R)-
(2R,5R)-1-{[(2R,5R)-2,5-Diphenylpyrrolidin-1-yl]methylene}-2, 5-diphenylpyrrolidinium tetrafluoroborate, min. 97% 1204324-08-2 C33H33BF4N2 544.43
(2R,5R)-1-{[(2R,5R)-2,5-Dimethylpyrrolidin-1-yl]methylene}-2, 5-dimethylpyrrolidinium tetrafluoroborate, min. 97% 1204324-14-0 C13H25BF4N2 296.16
(2R,5R)-1-{[(2R,5R)-2,5-Diethylpyrrolidin-1-yl]methylene}-2, 5-diethylpyrrolidinium tetrafluoroborate, min. 97% 1204324-20-8 C17H33BF4N2 352.26
(2R,5aS,7S,9aS)-7-Bromo-2-(bromomethyl)-2,5,5a,6,7,8,9,9a-oCtahydro-3,6,6,9a-tetramethyl-1-benzoxepin 77249-85-5 C15H24Br2O 380.16
(2R,4S,5R)-(+)-2,5-DIPHENYL-3,4-DIMETHYL-1,3,2-OXAZAPHOSPHOLIDINE-2-BORANE 130666-29-4 C16H21BNOP 285.13 (2R,4S,5R)-(+)-2,5-DIPHENYL-3,4-DIMETHYL-1,3,2-OXAZAPHOSPHOLIDINE-2-BORANE
(2R,4S)-FMOC-4-HYDROXYPIPERIDINE-2-CARBOXYLIC ACID 917099-02-6 C21H21NO5 367.4 (2R,4S)-FMOC-4-HYDROXYPIPERIDINE-2-CARBOXYLIC ACID
(2R,4S)-BOC-4-HYDROXYPIPERIDINE-2-CARBOXYLIC ACID 917835-93-9 C11H19NO5 245.27 (2S,4R)-BOC-4-HYDROXYPIPERIDINE-2-CARBOXYLIC ACID; (2R,4S)-BOC-4-HYDROXYPIPERIDINE-2-CARBOXYLIC ACID; BOC-(2S,4R)-4-HYDROXYPIPERIDINE-2-CARBOXYLIC ACID; BOC-L-CISHOMOPRO(4-HYDROXY)
(DL-Isoser1)-TRAP-6 150242-29-8 C34H56N10O9 748.87 DL-ISOSER-PHE-LEU-LEU-ARG-ASN; H-DL-ISOSER-PHE-LEU-LEU-ARG-ASN-OH; ISO-TRAP
(D-LEU6,PRO-NHET9)-LHRH (4-9) 202333-85-5 C37H62N10O8 774.95 H-SER-TYR-D-LEU-LEU-ARG-PRO-NHET; (D-LEU6,PRO-NHET9)-GONADOTROPIN-RELEASING HORMONE (4-9); (D-LEU6,PRO-NHET9)-LHRH (4-9); (D-LEU6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING FACTOR (4-9); (D-LEU6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING HORMONE (4-9)
(D-LEU2)-MELANOCYTE-STIMULATING HORMONE-RELEASE INHIBITING FACTOR 39705-60-7 C13H24N4O3 284.35 PRO-D-LEU-GLY-NH2; (D-LEU2)-MELANOCYTE-STIMULATING HORMONE-RELEASE INHIBITING FACTOR; [D-LEU2]-MELANOCYTE STIMULATING HORMONE-RELEASE INHIBITING FACTOR-1; [D-LEU2]-MIF-1; (D-LEU2)-MIF-I; H-PRO-D-LEU-GLY-NH2
(DL)-N-(Phenylacetyl)-3-amino-3-phenylpropanoic acid 65451-19-6
(DIPHENYLPHOSPHORYL)ACETONITRILE 23040-22-4 C14H12NOP 241.22 (DIPHENYLPHOSPHORYL)ACETONITRILE; IFLAB-BB F0873-0011; (DIPHENYL-PHOSPHINOYL)-ACETONITRILE
(Diphenylphosphonimido)triphenylphosphorane 2156-69-6 C30H25NOP2 477.47 (DIPHENYLPHOSPHONIMIDO)TRIPHENYLPHOSPHORANE; di(phenyl)phosphorylimino-tri(phenyl)-$l^{5}-phosphane; di(phenyl)phosphorylimino-tri(phenyl)phosphorane
(Diphenyl)bis(4-hydroxyphenyl)methane 1844-01-5 C25H20O2 352.43
(DI-N-OCTYLMETHYLSILYL)ETHYLTRICHLOROSILANE 475213-02-6 C19H41Cl3Si2 432.06 (DI-N-OCTYLMETHYLSILYL)ETHYLTRICHLOROSILANE
(Dimethylstannylene)bis(thioethane-1,2-diyl) dinonan-1-oate 68298-40-8 C24H48O4S2Sn
(Dimethylcyclohexyl) hydrogen phthalate 1322-94-7 C16H20O4 276.328 g/mol
(DIMETHYLAMINO)TRIMETHYLTIN 993-50-0 C5H15NSn 207.89 Dimethylaminotrimethylstannane; Stannanamine, pentamethyl-; PENTAMETHYLSTANNANAMINE; TRIMETHYLSTANNYLDIMETHYLAMIDE; (DIMETHYLAMINO)TRIMETHYLTIN; (Dimethylamino)trimethyltin(IV), technical grade; (dimethylamino)trimethyltin(iv); N-Methyl-N-(trimethylstanny
(Dimethylamino)methylphenyloxosulfoniumtetrafluoroborate 21077-81-6 C9H14BF4NOS 271.08 (DIMETHYLAMINO)METHYLPHENYLOXOSULFONIUMTETRAFLUOROBORATE; N,N,S-Trimethyl-S-phenylsulfox; N,N,S-Trimethyl-S-phenylsulfoximinium tetrafluoroborate, tech. 90%
(Dimethylamino)acetyl chloride 51552-16-0 C4H8ClNO 121.57 2-(dimethylamino)acetylchloride; (DIMETHYLAMINO)ACETYLCHLORIDE; dimethylaminoacetylchloride; N,N-dimethylglycinylchloride; 51552-16-0; dimethylamino-acetylchloride
(DIMETHYL(NORBORNENYLETHYL)SILYLOXY)HEP& 307496-42-0 C46H84O12Si8 1053.84
(Dimethoxymethyl)anisole 71617-08-8 C10H14O3 182.21636 (dimethoxymethyl)anisole
(Diiodine)bis(pentane-2,4-dionato-O,O')platinum 65849-16-3 C10H14I2O4Pt
(Difluoromethyl) 2,2,3,4,4,4-hexafluorobutyl 69948-46-5 C5H4F8O 232.07 (Difluoromethyl) 2,2,3,4,4,4-hexafluorobutyl; 2,2,3,4,4,4-Hexafluorobutyl (difluoromethyl)ether
(DIFLUOROMETHOXY)BENZENE 458-92-4 C7H6F2O 144.12 alpha,alpha-Difluoroanisole; (Difluoromethoxy)benzene
(difluoromethoxy)benzaldehyde 66988-93-0 C8H6F2O2 172.1288464 (difluoromethoxy)benzaldehyde
(Diethylamino)methanol 15931-59-6 C5H13NO 103.16 (DIETHYLAMINO)METHANOL; Einecs 240-069-6; Methanol, (diethylamino)-; Methanol, 1-(diethylamino)-
(Diethylamino)diethylphosphine 686-20-4 C8H20NP 161.224861 (DIETHYLAMINO)DIETHYLPHOSPHINE
(DIETHOXYPHOSPHORYL)DIFLUOROACETIC ACID 97480-37-0 C6H11F2O5P 232.12 (DIETHOXYPHOSPHORYL)DIFLUOROACETIC ACID; 2-(DIETHOXYPHOSPHORYL) DIFLUOROACETIC ACID; DIETHYLDIFLUOROPHOSPONOACETIC ACID
(Dichloromethyl)trichlorosilane 1558-24-3 CHCl5Si 218.37 (DICHLOROMETHYL)TRICHLOROSILANE; TRICHLORO(DICHLOROMETHYL)SILANE; Silane, trichloro(dichloromethyl)-; trichloro(dichloromethyl)-silan; Dichloromethyltrichlorosilane7%; (Trichlorosilyl)dichloromethane
(Dichloromethyl)methyldichlorosilane 1558-31-2 C2H4Cl4Si 197.95 dichloro(dichloromethyl)methyl-silan; (DICHLOROMETHYL)METHYLDICHLOROSILANE; dichloro(dichloromethyl)methylsilane
(Dichloromethyl)dimethyl-n-propylsilane 207853-68-7 C6H14Cl2Si 185.17 (DICHLOROMETHYL)DIMETHYL-N-PROPYLSILANE; (DICHLOROMETHYL)DIMETHYL-N-PROPYLSILANE 94%
(DICHLOROMETHYL)DIMETHYL-N-PROPYLSILANE 18145-85-2 C6H14Cl2Si 185.17 (DICHLOROMETHYL)DIMETHYL-N-PROPYLSILANE
(DICHLOROMETHYL)(CHLOROMETHYL)DIMETHYLSILANE 18171-70-5 C4H9Cl3Si 191.56 (DICHLOROMETHYL)(CHLOROMETHYL)DIMETHYLSILANE
(Dichlorofluoromethyl)benzene 498-67-9 C7H5Cl2F 179.0190032 a,a-Dichloro-a-fluorotoluene
(Dichlorobenzyl)dodecyldimethylammonium, salt with 4-bromo-2,6-xylenol (1:1) 85940-48-3 C29H44BrCl2NO 573.47600
(Dichloro)dipropylsilane 2295-24-1 C6H14Cl2Si 185.17 (Dichloro)dipropylsilane; Dichlorodi-n-propylsilane
(dibutylstannylene)bis(thioethylene) dimethyl diadipate 70969-72-1 C26H44O8S2Sn-4 667.46276 (dibutylstannylene)bis(thioethylene) dimethyl diadipate; 5,5'-[(Dibutylstannylene)bis[thio-2,1-ethanediyl(oxy)carbonyl]]bis[pentanoic acid]dimethyl ester
(DIBENZYLAMINO)ACETIC ACID 17360-47-3 C16H17NO2 255.31 (DIBENZYLAMINO)ACETIC ACID; IFLAB-BB F0777-0033; AKOS BBS-00004699
(D-His(Bzl)6,Pro-NHEt9)-LHRH (4-9) 134009-09-9 C44H64N12O8 889.05 (D-HIS(BZL)6,PRO-NHET9)-GONADOTROPIN-RELEASING HORMONE (4-9); (D-HIS(BZL)6,PRO-NHET9)-LHRH (4-9); (D-HIS(BZL)6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING FACTOR (4-9); (D-HIS(BZL)6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING HORMONE (4-9); H-SER-TYR-D-HIS(BZL)
(D-gluconato-O1,O2)(D-glycero-D-gluco-heptonato-O1,O2)magnesium 18312-25-9 C13H24MgO15 0 (D-gluconato-O1,O2)(D-glycero-D-gluco-heptonato-O1,O2)magnesium; Magnesium glucoheptonate-gluconate; Einecs 242-199-9
(D-gluconato-O1,O2)(D-gluco-heptonato-O1,O2)calcium 94233-02-0 C13H24CaO15 0 (D-gluconato-O1,O2)(D-gluco-heptonato-O1,O2)calcium; Calcium, (D-gluconato-O1,O2)(D- gluco-heptonato-O1,O2)-
(D-gluconato-O1)(D-glycero-D-ido-heptonato-O1)calcium 95873-62-4 C13H24CaO15 0 (D-gluconato-O1)(D-glycero-D-ido-heptonato-O1)calcium; [(D-Glucos-1-yl)oxy][(D-glycero-D-ido-heptos-1-yl)oxy]calcium salt
(Des-Gly10,D-Ser4,D-Leu6,Pro-NHEt9)-LHRH 62621-13-0 C59H84N16O12 1209.4 PYR-HIS-TRP-D-SER-TYR-D-LEU-LEU-ARG-PRO-NHET; (D-SER4)-LEUPROLIDE; (D-SER4)-LEUPRORELIN; (DES-GLY10,D-SER4,D-LEU6,PRO-NHET9)-LHRH
(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH 147688-42-4 C58H83N17O13 1226.39 (DES-GLY10,D-SER(TBU)6,PRO-NHNH(2/9))-GONADOTROPIN-RELEASING HORMONE; (DES-GLY10,D-SER(TBU)6,PRO-NHNH(2/9))-LHRH; (DES-GLY10,D-SER(TBU)6,PRO-NHNH(2/9))-LUTEINIZING HORMONE-RELEASING FACTOR; (DES-GLY10,D-SER(TBU)6,PRO-NHNH(2/9))-LUTEINIZING HORMONE-RELEASI
(Des-Gly10,D-Arg6,Pro-NHEt9)-LHRH II (chicken) 145940-57-4 C64H79N19O12 1224.37 (DES-GLY10,D-ARG6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING FACTOR (CHICKEN); (DES-GLY10,D-ARG6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING HORMONE (CHICKEN); (DES-GLY10,D-ARG6,PRO-NHET9)-GONADOTROPIN-RELEASING HORMONE (CHICKEN); (DES-GLY10,D-ARG6,PRO-NHET9)-
(Des-Gly10,D-Ala6,Pro-NHEt9)-LHRH II (chicken) 319432-42-3 C61H72N16O12 1139.26 (DES-GLY10,D-ALA6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING FACTOR (CHICKEN); (DES-GLY10,D-ALA6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING HORMONE (CHICKEN); (DES-GLY10,D-ALA6,PRO-NHET9)-LHRH; (DES-GLY10,D-ALA6,PRO-NHET9)-GONADOTROPIN-RELEASING HORMONE (CHIC
(Deamino-Phe19,D-Ala24,D-Pro26-(R)-Phe27)-GRP (19-27) (human, porcine, canine) 142061-53-8 C57H72N14O8 1081.27 (Deamino-Phe19,D-Ala24,D-Pro26-(R)-Phe27)-GRP (19-27) (human, porcine, canine); Deamino-Phe-His-Trp-Ala-Val-D-Ala-His-D-Pro-psi[CH2NH]-Phe-NH2
(Deamino-Cys1,Lys8)-Vasopressin 2989-84-6 C46H64N12O12S2 0 (DEAMINO-CYS1,LYS8)-VASOPRESSIN; 3-MERCAPTOPROPIONYL-TYR-PHE-GLN-ASN-CYS-PRO-LYS-GLY-NH2, (DISULFIDE BOND)
(D-Bpa13,Tyr19)-MCH (human, mouse, rat) 183606-10-2 C116H164N30O27S4 2538.99 (D-BPA13,TYR19)-MCH (HUMAN, MOUSE, RAT); [D-BPA13, TYR19]-MELANIN-CONCENTRATING HORMONE (HUMAN, MOUSE, RAT); H-ASP-PHE-ASP-MET-LEU-ARG-CYS-MET-LEU-GLY-ARG-VAL-D-BPA-ARG-PRO-CYS-TRP-GLN-TYR-OH; H-ASP-PHE-ASP-MET-LEU-ARG-CYS-MET-LEU-GLY-ARG-VAL-P-BZ-D-PHE-A
(D-Arg8)-Dynorphin A (1-13) 125357-12-2 C75H127N27O15 1646.98 YGGFLRRRRPKLK; TYR-GLY-GLY-PHE-LEU-ARG-ARG-D-ARG-ARG-PRO-LYS-LEU-LYS; DYNORPHIN A PORCINE [D-ARG8]-FRAGMENT 1-13; (D-ARG8)-DYNORPHIN A (1-13); [D-ARG8]-DYNORPHIN A (1-13), PORCINE; H-TYR-GLY-GLY-PHE-LEU-ARG-ARG-D-ARG-ARG-PRO-LYS-LEU-LYS-OH
(D-Arg2)-Kyotorphin 70904-57-3 C15H23N5O4 397.43 H-TYR-D-ARG-OH ACETATE SALT; H-TYR-D-ARG-OH ACOH; (D-ARG2)-KYOTORPHIN; (D-ARG2)-KYOTORPHIN ACETATE SALT; TYR-D-ARG ACETATE SALT; H-Tyr-D-Arg-OH
(D-ARG0,HYP3,D-PHE7)-BRADYKININ 109333-26-8 C60H87N19O13 1282.45 npc567; H-D-ARG-ARG-PRO-HYP-GLY-PHE-SER-D-PHE-PHE-ARG-OH; D-ARG-ARG-PRO-HYP-GLY-PHE-SER-D-PHE-PHE-ARG; D-ARG-ARG-PRO-HYDROXY-PRO-GLY-PHE-SER-D-PHE-PHE-ARG; D-ARG-[HYP3,D-PHE7]-BRADYKININ; (D-ARG0,HYP3,D-PHE7)-BRADYKININ; (D-Arg0,Hyp3,D-Phe7)bradikinin; D-
(D-Ala1)-Peptide T 106362-33-8 C35H55N9O16 857.86 H-D-ALA-SER-THR-THR-THR-ASN-TYR-THR-OH; D-ALA-SER-THR-THR-THR-ASN-TYR-THR; (D-ALA1)-PEPTIDE T; L-Threonine, D-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparaginyl-L-tyrosyl-; L-Threonine, N-(N-(N2-(N-(N-(N-(N-D-alanyl-L-seryl)-L-threonyl)-L-threo
(D,L)-(+,-)-2-Amino-4-(diethylphosphono)butanoic acid ethyl ester hydrochloride 156393-79-2 C10H23ClNO5P 303.72 (D,L)-(+/-)-2-AMINO-4-(DIETHYLPHOSPHONO)BUTANOIC ACID, ETHYL ESTER, HYDROCHLORIDE
(D(CH2)(5/1),D-TYR(ET)2,VAL4,ARG8,DES-GLY9)-VASOPRESSIN 90332-82-4 C51H74N12O10S2 1079.34 (D(CH2)(5/1),D-TYR(ET)2,VAL4,ARG8,DES-GLY9)-VASOPRESSIN; BETA-MERCAPTO-BETA,BETA-CYCLOPENTAMETHYLENE-PROPIONYL-D-TYR-(ET)-PHE-VAL-ASN-CYS-PRO-ARG-NH2; SK&F 101926; beta-Mercapto-beta,beta-cyclopentamethylene-propionyl-D-Tyr(Et)-Phe-Val-Asn-Cys-Pro-Arg-NH2
(Cys39)-Tissue Factor (33-53) 313642-01-2 C111H166N26O33S2 2456.79 VAL-TYR-THR-VAL-GLN-ILE-CYS-THR-LYS-SER-GLY-ASP-TRP-LYS-SER-LYS-CYS-PHE-TYR-THR-THR; (CYS39)-TISSUE FACTOR (33-53); H-VAL-TYR-THR-VAL-GLN-ILE-CYS-THR-LYS-SER-GLY-ASP-TRP-LYS-SER-LYS-CYS-PHE-TYR-THR-THR-OH; H-Val-Tyr-Thr-Val-Gln-Ile-Cys-Thr-Lys-Ser-Gly-Asp
(Cys3,6,Tyr8,Pro9)-Substance P 141459-28-1 C61H90N16O13S3 1351.66 (CYS3,6,TYR8,PRO9)-SUBSTANCE P; H-ARG-PRO-CYS-PRO-GLN-CYS-PHE-TYR-PRO-LEU-MET-NH2; H-ARG-PRO-CYS-PRO-GLN-CYS-PHE-TYR-PRO-LEU-MET-NH2 (DISULFIDE BRIDGE: 3-6); RPCPQCFYPLM-NH2 (DISULFIDE BRIDGE: 3-6); H-Arg-Pro-Cys-Pro-Gln-Cys-Phe-Tyr-Pro-Leu-Met-NH2 (Disul
(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) 128806-04-2 C96H158N32O23S2 0 TYR-CYS-SER-LYS-8-AMINOOCTANOYL-ARG-HIS-D-CYS-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2; C2-NPY; (CYS2,8-AMINOOCTANOIC ACID5,24,D-CYS27)-NEUROPEPTIDE Y; (CYS2)-NEUROPEPTIDE Y (1-4)-8-AMINOOCTANOYL-(D-CYS27)-NEUROPEPTIDE Y (25-32); H-TYR-CYS-SER-LYS-8-AMINOO
(CYCLOPROPYLMETHYL)TRIPHENYLPHOSPHONIUM BROMIDE 14799-82-7 C22H22BrP 397.29 (CYCLOPROPYLMETHYL)TRIPHENYLPHOSPHONIUM BROMIDE; (CYCLOPROPYLMETHYL)TRIPHENYLPHOSPHONIUM BROMIDE, 98+%
(Cyclopentylthio)acetic acid 52363-14-1 C7H12O2S 160.23 Acetic acid, (cyclopentylthio)- (9CI)
(Cyclopentyloxymethyl)benzene 40843-99-0 C12H16O 0 (Cyclopentyloxymethyl)benzene
(CYCLOPENTADIENYL)(1,3-DIMETHYLCYCLOPENTADIENYL)ZIRCONIUM DICHLORIDE 214622-15-8 C12H14Cl2Zr 10* 320.37 (CYCLOPENTADIENYL)(1,3-DIMETHYLCYCLOPENTADIENYL)ZIRCONIUM DICHLORIDE
(cyclohexylmethylene)malononitrile 73776-46-2 C10H12N2 160.21600
(Cyclohexylmethyl)trichlorosilane 18388-16-4 C7H13Cl3Si 231.62 (CYCLOHEXYLMETHYL)TRICHLOROSILANE; trichloro(cyclohexylmethyl)silane; (CYCLOHEXYLMETHYL)TRICHLOROSILANE 97%; Trichlorosilyl(cyclohexyl)methane; Cyclohexane, ((trichlorosilyl)methyl)-; Einecs 242-265-7; Silane, trichloro(cyclohexylmethyl)-
(Cyclohexylmethyl)pyrazine 28217-92-7 C11H16N2
(Cyclohexylaminomethyl)xylenol 85187-49-1 C15H23NO 233.34922 (cyclohexylaminomethyl)xylenol; Einecs 286-140-5
(Cyclohexanecarbonyl-amino)-acetic acid 32377-88-1 C9H15NO3 185.220
(CYANO-PHENYL-METHYL)-CARBAMIC ACID TERT-BUTYL ESTER 78558-73-3 C13H16N2O2 232.27834 (CYANO-PHENYL-METHYL)-CARBAMIC ACID TERT-BUTYL ESTER
(cyanomethyl)urea 5962-02-7 C3H5N3O 99.0913
(Cyanomethyl)triphenylphosphoniumbromide 15898-47-2 C20H17BrNP 382.23 (CYANOMETHYL)TRIPHENYLPHOSPHONIUM BROMIDE
(Cyanomethyl)trimethylammonium iodide 82272-28-4 C5H11N2 I 226.06 (N-Iodo-N,N,N-trimethylamino)acetonitrile, 1-Cyano-N,N,N-trimethyl-methanaminium iodide, 2-(Dimethylamino)acetonitrile methyl iodide
(CIS-2-AMINO-TRANS-5-PHENYL-CYCLOHEXYL)-METHANOL HYDROCHLORIDE 1212211-92-1 C13H20ClNO 241.76 (CIS-2-AMINO-TRANS-5-PHENYL-CYCLOHEXYL)-METHANOL HYDROCHLORIDE
(CIS-2-AMINO-2-METHYL-CYCLOPENTYL)-METHANOL HYDROCHLORIDE 1212406-48-8 C7H16ClNO 165.66 (CIS-2-AMINO-2-METHYL-CYCLOPENTYL)-METHANOL HYDROCHLORIDE
(cis-1-Benzylamino-indan-2-yl)-methanol 683754-91-8 C17H19NO 253.34 (CIS-1-BENZYLAMINO-INDAN-2-YL)-METHANOL
(cis/trans) 3-Methylcyclohexylamine 6850-35-7 C7H15N 113.2 (cis/trans) 3-Methylcyclohexylamine; 3-Methylcyclohexanamine; (3-Methylcyclohexyl)amine
(Cinnamyl)triphenylphosphonium chloride 1530-35-4 C27H24ClP 414.91 triphenyl(3-phenyl-2-propenyl)-phosphoniuchloride; CINNAMYLTRIPHENYLPHOSPHONIUM CHLORIDE; (3-Phenyl-2-propenyl)triphenylphosphonium chloride; Cinnamyltriphenylphosphonium chloride, 98 %
(Cinnamyl)triphenylphosphonium bromide 7310-74-9 C6H5CH=CHCH2P(C6H5)3Br 459.36 (Cinnamyl)triphenylphosphonium bromide; Cinnamyl triphenylphosphonium bromide
(Chroman-3-yl)methanamine 10185-46-3 C10H13NO 163.22 (Chroman-3-yl)methanamine; C-Chroman-3-yl-methylamine; Chroman-3-yl-methylamine; 1-(3,4-Dihydro-2H-chromen-3-yl)methanamine hydrochloride
(Chloropropyl)methylsiloxane - dimethylsiloxane copolymer 70900-20-8 0 SiloxanesandSilicones,3-chloropropylMe,di-Me; (CHLOROPROPYL)METHYLSILOXANE, DIMETHYLSILOXANE COPOLYMER; (CHLOROPROPYL)METHYLSILOXANE - DIMETHYLSILOXANE COPOLYMERS; Polydimethylsiloxane, diacetoxymethyl terminated, viscosity 2500-3500 cSt.; 14-16% (CHLOROP
(Chloromethylene)dimethyliminium chloride 3724-43-4 C3H7Cl2N 128.00 (CHLOROMETHYLENE)DIMETHYLAMMONIUM CHLORIDE; CHLOROMETHYLENEDIMETHYLIMINIUM CHLORIDE; N-CHLOROMETHYLEN-N,N-DIMETHYLAMMONIUM CHLORIDE; VILSMEIER REAGENT; (Chloromethylene)dimethylammoniumchlorlde; n-(chloromethylene)-n-methyl-methanaminiuchloride
(Chloromethyl)triethoxysilane 15267-95-5 C7H17ClO3Si 212.75 CHLOROMETHYLTRIETHOXYSILANE; (chloromethyl)triethoxy-silan; chlormethyl-triethoxysilan; triethoxy(chloromethyl)-silan; Silane, triethoxy(chloromethyl)-
(Chloromethyl)-methyldimethoxysilane 11-21-2
(Chloromethyl)methyldichlorosilane 1558-33-4 C2H5Cl3Si 163.51
(Chloromethyl)dodecylbenzene 28061-21-4 C19H31Cl 294.91 1-(chloromethyl)-4-dodecylbenzene;p-Dodecylbenzylchloride;UNII-2YWB85O81H;1-(Chloromethyl)-4-dodecylbenzene;4-Laurylbenzylchloride;4-Dodecylbenzylchloride
(Chloromethyl)diphenylphosphine Oxide 1806-49-1 C13H12ClOP 250.66 (Chloromethyl)diphenyl-phosphine Oxide;
(Chloromethyl)dimethylethylsilane 3121-77-5 C3H9ClSi 108.64 CHLOROMETHYLDIMETHYLSILANE; (CHLOROMETHYL)DIMETHYLETHYLSILANE; (CHLOROMETHYL)DIMETHYLETHYLSILANE 98%
(Chloromethyl)(4-chlorophenyl)dioxo-lambda~6~-sulfane 5943-04-4 C7H6Cl2O2S 225.09
(Chloromethoxymethyl)benzene 35364-99-9 C8H9ClO 156.61 Benzylchloromethylether; 3587-60-8; (Chloromethoxymethyl)benzene; Benzyloxymethylchloride; ((Chloromethoxy)methyl)benzene; [(chloromethoxy)methyl]benzene
(CHLORODIMETHYLSILYL)-6-[2-(CHLORODIMETHYLSILYL)ETHYL]BICYCLOHEPTANE 220527-24-2 C13H26Cl2Si2 309.42 (CHLORODIMETHYLSILYL)-6-[2-(CHLORODIMETHYLSILYL)ETHYL]BICYCLOHEPTANE
(Carboxymethyloximino)spiperone, hemihydrate 355012-90-7 C25H29FN4O4.0.5H2O 480.49 CMOS; (CARBOXYMETHYLOXIMINO)SPIPERONE, HEMIHYDRATE
(Carboxymethyl)trimethylammonium 3,7,12-trioxocholan-24-oate 18434-76-9 C24H33O5.C5H12NO2
(Carboxymethyl)dodecyldimethylammonium chloride 55142-08-0 C16H34ClNO2 307.89966 (carboxymethyl)dodecyldimethylammonium chloride
(Carboxymethyl)dimethyloleylammonium hydroxide 871-37-4 C22H43NO2 371.5976 (carboxymethyl)dimethyloleylammonium hydroxide; OLEYL BETAINE; 9-Octadecen-1-aminium, N-(carboxymethyl)-N,N-dimethyl-, inner salt, (9Z)-; oleyldimethylbetaine; N-(Carboxylatomethyl)-N,N-dimethyl-9-octadecen-1-aminium; 9-Octadecen-1-aminium, N-(carboxymeth
(carboxymethyl)dimethyl-3-[(1-oxooctadecyl)amino]propylammonium hydroxide 6179-44-8 C25H52N2O4 444.69138
(Carboxymethyl)dimethyl[3-[(1-oxoundecenyl)amino]propyl]ammonium hydroxide 98510-75-9 C18H34N2O3
(Carboxymethyl)decyldimethylammonium hydroxide 2644-45-3 C14H29NO2 243.386 g/mol
(CARBINOL FUNCTIONAL)METHYLSILOXANE-DIMETHYLSILOXANE COPOLYMER 68957-00-6 C5H8O2 100.11582 neglycolmonoallylether; SiloxanesandSilicones,di-Me,Mehydrogen,reactionproductswithpolypropyleneglycolmonoallylether; (CARBINOL FUNCTIONAL)METHYLSILOXANE-DIMETHYLSILOXANE COPOLYMER; HYDROXYETHYLENEOXYPROPYLMETHYLSILOXANE, DIMETHYLSILOXANE COPOLYMER; (5% H
(Carbethoxymethyl-1,2-13C2)triphenylphosphonium bromide 109376-35-4 431.27
(C20:0) COENZYME A 15895-27-9 C41H74N7O17P3S 1062.05 EICOSANOYL COENZYME A; (C20:0) COENZYME A; ARACHIDOYL COENZYME A; ARACHIDOYL COENZYME A (C20:0) FREE ACID; ARACHINOYL-COENZYME A HYDRATE; Eicosanoyl-CoA; S-[2-[3-[[(2R)-4-[[[(2R,3R,5R)-5-(6-aminopurin-9-yl)-4-hydroxy-3-phosphonooxyoxolan-2-yl]methoxy-hydr
(C16-C18) Alkyl alcohol ethoxylate propoxylate 68002-96-0
(Butanedione dioximato)disodium 60908-54-5 C4H8N2O2.2Na 160.08 SODIUM DIMETHYLGLOXIMATE; SODIUM DIMETHYLGLYOXIMATE; SODIUM DIMETHYLGLYOXIME; 2,3-BUTANEDIONE DIOXIME DISODIUM SALT; 2,3-BUTANEDIONE DIOXIME, SODIUM SALT; 2 3-DIISONITROSOBUTANE DISODIUM SALT; DIACETYLDIOXIME; DIACETYLDIOXIME DISODIUM SALT
(Butan-2-olato)bis(propan-2-olato)aluminum 3605-65-0 C10H23AlO3 218.27
(BROMOMETHYL-D2)CYCLOPROPANE-1-D1 1219799-17-3 C4H4BrD3 138.02 (BROMOMETHYL-D2)CYCLOPROPANE-1-D1
(bR)-b-Amino-3-(trifluoromethyl)benzenebutanoic acid 269726-73-0 C11H12F3NO2.HCl 283.67 (bR)-b-Amino-3-(trifluoromethyl)benzenebutanoic acid; 3-Trifluoromethyl-D-beta-homophenylalanine hydrochloride
(bR)-b-Amino-2,4-dichlorobenzenebutanoic acid 269396-52-3 C10H11Cl2NO2 248.10584;g/mol AC1NWJEZ;269396-52-3;SCHEMBL2035670;ZINC2385853;AJ-35210;(bR)-b-Amino-2,4-dichlorobenzenebutanoicacid
(bR)-b-Amino-2-(trifluoromethyl)benzenebutanoic acid 269396-76-1 C11H12F3NO2.HCl 283.67 (bR)-b-Amino-2-(trifluoromethyl)benzenebutanoic acid; 2-Trifluoromethyl-D-beta-homophenylalanine hydrochloride
(Boc-G(Z)-Aeg-OH) 169287-77-8 C24H29 N7 O8 0 (Boc-G(Z)-Aeg-OH); Boc-PNA-G(Z)-OH
(BOC-[1-(4-HYDROXYPHENYL)ETHYL]AMINO)ACETIC ACID METHYL ESTER 917562-10-8 C16H23NO5 309.36 (BOC-[1-(4-HYDROXYPHENYL)ETHYL]AMINO)ACETIC ACID METHYL ESTER
(Boc)2-15NH 137052-25-6 C10H1915NO4 218.26 (BOC)2-15NH; DI-T-BUTYL-[15N]IMIDODICARBONATE
(bis-(Trimethylsilyl))telluride 4551-16-0 C6H18Si2Te 273.98 Bis(trimethylsilyl)tellurium; Disilatellurane,hexamethyl-; Disiltellurane,hexamethyl-; hexamethyl-disilatellane; Silane,tellurobis[trimethyl-; (BIS(TRIMETHYLSILYL))TELLURIDE; (BIS(TRIMETHYLSILYL))TELLURIDE 98%; Bis(trimethylsilyl)telluride,98%
(BIPHENYL-4-CARBONYL)-AMINO]-ACETIC ACID 75446-59-2 C15H13NO3 255.272
(Biphenyl-2-yloxy)-acetic acid 5348-75-4 C14H12O3
(Biotinyl-Gln1)-LHRH 218433-98-8 C65H92N20O15S 1425.62 BIOTINYL-LH-RH (HUMAN); BIOTINYL-LUTEINIZING HORMONE-RELEASING HORMONE (HUMAN); BIOTINYL-GLN-HIS-TRP-SER-TYR-GLY-LEU-ARG-PRO-GLY-NH2; (BIOTINYL-GLN1)-GONADOTROPIN-RELEASING HORMONE; (BIOTINYL-GLN1)-LHRH; (BIOTINYL-GLN1)-LUTEINIZING HORMONE-RELEASING FACTO
(BICYCLO[2.2.1]HEPTA-2,5-DIENE)TETRACARB ONYLMOLYBDENUM,95% 12146-37-1 C11H8MoO4 300.12
(BICYCLO[2.2.1]HEPTA-2,5-DIENE)[1,4-BIS(DIPHENYLPHOSPHINO)BUTANE]RHODIUM(I) TETRAFLUOROBORATE 82499-43-2 C35H36BF4P2Rh 708.32
(BICYCLO[2.2.1]HEPTA-2,5-DIENE)[1,1'-BIS(DIPHENYLPHOSPHINO)-FERROCENE] RHODIUM(I) PERCHLORATE 84680-96-6 C41H36ClFeO4P2Rh 10* 848.87
(BICYCLO(2.2.1)HEPTA-2,5-DIENE)(BIS-(TRIPHENYLPHOSPHINE))RHODIUM (I) PF6 32799-32-9 C43H34F6P3Rh 860.54700
(Benzylsulfonyl)acetic acid 28203-59-0 C9H10O4S 214.24 2-benzylsulfonylacetic acid; Phenylmethanesulfonylacetic acid; (Benzylsulfonyl)acetic acid
(benzyloxy)methanol 14548-60-8 C8H10O2 138.1638 (benzyloxy)methanol; BENZYLHEMIFORMAL; Methanol, (phenylmethoxy)-; (phenylmethoxy)-methanol
(BENZYL-[2-(BENZYL-ETHOXYCARBONYLMETHYL-AMINO)-ETHYL]-AMINO)-ACETIC ACID ETHYL ESTER 183995-63-3 C24H32N2O4 412.52 (BENZYL-[2-(BENZYL-ETHOXYCARBONYLMETHYL-AMINO)-ETHYL]-AMINO)-ACETIC ACID ETHYL ESTER
(Benzoyl chloride)pentachloroantimony 38897-60-8 C7H5Cl6OSb
(Benzotriazol-1-yloxy)dipiperidinocarbenium tetrafluoroborate 136605-16-8 C17H24BF4N5O 401.21 (BENZOTRIAZOL-1-YLOXY)DIPIPERIDINOCARBENIUM TETRAFLUOROBORATE; O-(BENZOTRIAZOL-1-YL)-N,N,N',N'-BIS(PENTAMETHYLENE)URONIUM TETRAFLUOROBORATE; O(BENZOTRIAZOL-1-YL)-N N N' N'-BIS(PEN-&
(Benzoato-O,O')hydroxy(octadecanoato-O,O')aluminum 54326-11-3 C25H41AlO5
(BENZO-15-CROWN 5-ETHER)-4'-CARBOXYLIC ACID 56683-55-7 C15H20O7 312.32 (Benzo-15-crown 5-Ether)-4-carboxylic Acid
(AZA((4-FLUOROPHENYL)AMINO)METHYLENE)METHANE-1,1-DICARBONITRILE 94853-74-4 C9H5FN4 188.16 (AZA((4-FLUOROPHENYL)AMINO)METHYLENE)METHANE-1,1-DICARBONITRILE; AKOS UB-20044
(aZ)-2-Amino-5-chloro-a-(hydroxyimino)-4-thiazoleacetic acid ethyl ester monohydrochloride 306748-30-1 C21H23ClF3N3O2 441.87443;g/mol (3R)-3-amino-1-(2-benzoyldiazinan-1-yl)-4-(2,4,5-trifluorophenyl)butan-1-one;hydrochloride;CHEMBL535180
(aS)-a-(Ethylamino)benzeneethanol 1063734-78-0 C10H15NO 0 (aS)-a-(Ethylamino)benzeneethanol; (S)-2-(Ethylamino)-2-phenylethanol
(a-RS,2R)-Fluvalinate 102851-06-9 C26H22ClF3N2O3 502.92 t-Fluvalinate; TAU-FLUVALINATE 250MG; TAU-FLUVALINATE PESTANAL, 250 MG; MAVRIK, 100MG, NEAT; (alpha-RS,2R)-Fluvalinate; D-Valine, N-2-chloro-4-(trifluoromethyl)phenyl-, cyano(3-phenoxyphenyl)methyl ester
(Arg8)-Vasopressin (4-9) 96027-30-4 C25H44N12O8S 672.76 H-GLN-ASN-CYS-PRO-ARG-GLY-NH2; (ARG8)-VASOPRESSIN (4-9)
(aR,bS)-rel-a-Hydroxy-b-[[(phenylmethoxy)carbonyl]amino]-benzenebutanoic acid 76498-22-1 C18H19NO5 329.35 (aR,bS)-rel-alpha-Hydroxy-beta-[[(phenylmethoxy)carbonyl]amino]benzenebutanoic acid
(aR,4S)-rel-5-Ethyl-4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-3-pyridinemethanol 202917-22-4 C21H28FNO2 347.471 3-Pyridinemethanol, 5-ethyl-4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-, (aR,4S)-rel- (9CI); 3-Pyridinemethanol, 5-ethyl-4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-, (aR,4S)-rel-
(aR,4S)-rel-4-(4-Fluoro-2-hydroxyphenyl)-รก-methyl-2,6-bis(1-methylethyl)-5-pentyl-3-pyridinemethanol 202917-16-6 C24H34FNO2 389.551 3-Pyridinemethanol, 4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-5-pentyl-, (aR,4S)-rel- (9CI)
(aR,4R)-rel-5-Ethyl-4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-3-pyridinemethanol 202917-21-3 C21H28FNO2 347.471 3-Pyridinemethanol, 5-ethyl-4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-, (aR,4R)-rel- (9CI)
(aR)-a-Methyl-1-Cyclopentene-1-methanol 172139-04-7 C7H12O 202.29542;g/mol cis-2-Benzyloctahydropyrrolo[3,4-c]pyrrole; 172739-04-7; (3aR,6aS)-2-benzyloctahydropyrrolo[3,4-c]pyrrole; cis-2-Benzylhexahydropyrrolo[3,4-c]pyrrole; 172139-04-7; CIS-2-BENZYLOCTAHYDROPYRROLO(3,4-C)PYRROLE
(aR)-a-Amino-1H-pyrrolo[2,3-b]pyridine-3-propanoic acid 134235-82-8 C10H11N3O2 205.216 (aR)-a-Amino-1H-pyrrolo[2,3-b]pyridine-3-propanoic acid; D-7-Azatryptophan
(Aminomethylene)bisphosphonic acid 29712-28-5 CH7NO6P2 191.016902 (aminomethylene)bisphosphonic acid; Phosphonic acid, (aminomethylene)bis-
(AMINOETHYLAMINOMETHYL)PHENETHYLTRIMETHOXYSILANE 74113-77-2 C14H26N2O3Si 298.45 (AMINOETHYLAMINOMETHYL)PHENETHYLTRIMETHOXYSILANE; 2-Ethanediamine,N-[[[2-(trimethoxysilyl)ethyl]phenyl]methyl]-1; n-[[[2-(trimethoxysilyl)ethyl]phenyl]methyl]-2-ethanediamine; (AMINOETHYLAMINOMETHYL)PHENETHYLTRIMETHOXYSILANE: 90% MIXED M, P-ISOMERS; (Amin
(all-Z)-6,9,12,15,18-Heneicosapentaenoic Acid Ethyl Ester 131775-86-5 C23H36O2 344.53 (6Z,9Z,12Z,15Z,18Z)-6,9,12,15,18-Heneicosapentaenoic Acid Ethyl Ester;
(ALLYLOXYCARBONYL)METHYLTRIPHENYLPHOSPHONIUM CHLORIDE 100687-15-8 C23H22ClO2P 396.85 (ALLYLOXYCARBONYL)METHYLTRIPHENYLPHOSPHONIUM CHLORIDE; (Allyloxycarbonyl)methyltriphenylphosphonium chloride, 97 %
(ALLYLOXY) CYCLODODCANE >98% 2986-72-3
(ALA6,D-TRP8,L-ALANINOL15)-GALANIN (1-15) 184683-37-2 C83H115N21O17 1678.93 (ALA6,D-TRP8,L-ALANINOL15)-GALANIN (1-15); H-GLY-TRP-THR-LEU-ASN-ALA-ALA-D-TRP-TYR-LEU-LEU-GLY-PRO-HIS-L-ALANINOL
(acetyloxy)(4-nitrophenyl)methyl acetate 2929-91-1 C11H11NO6 253.21 P-NITROBENZAL DIACETATE; 4-nitrobenzylidene di(acetate); (4-Nitrophenyl)methanediol diacetate; 1-(Diacetoxymethyl)-4-nitrobenzene; 4-Nitrophenylmethanediol diacetate; Diacetic acid (4-nitrophenyl)methylene ester
(acetyloxy)(2-nitrophenyl)methyl acetate 6345-63-7 C11H11NO6 253.20814 2-nitrobenzylidene di(acetate); 2-Nitrobenzaldiacetate; (2-Nitrophenyl)diacetoxymethane; (2-Nitrophenyl)methanediol diacetate; 2-Nitro-1-(diacetoxymethyl)benzene; 2-Nitrophenylmethanediol diacetate; Diacetic acid o-nitrobenzylidene ester
(ACETOXYETHYL)HEPTAMETHYLCYCLOTETRASILOXANE 18048-31-2 C11H28O6Si4 368.68 (ACETOXYETHYL)HEPTAMETHYLCYCLOTETRASILOXANE
(acetato-O)(stearato-O)calcium 94386-19-3 C20H38CaO4 0 (acetato-O)(stearato-O)calcium; Calcium acetateoctadecanoate
(9Z,12Z)-octadeca-9,12-dienoic acid, compound with 2,2'-iminodiethanol (1:1) 59231-42-4 C18H32O2.C4H11NO2
(9Z,12Z)-Octadeca-9,12-dienoic acid, compound with (Z)-octadec-9-enylamine (1:1) 93777-50-5
(9Z,12Z)-1,3-bis(octadeca-9,12-dienoyloxy)-1,1,3,3-tetraoctyldistannoxane 85938-45-0 C68H130O5Sn2 1265.16000
(9Z,12E)-TETRADECADIENOL , 95 % 42521-46-0
(9Z,11E)-9,11-tetradecadien-1-ol acetate 50767-79-8 C16H28O2 252.44 Z,E-9,11-TETRADECADIENYL ACETATE; (z,e)-9,11-tetradecadien-1-yl; (z,e)-9,11-tetradecadien-1-ylacetate; acetate,(e,z)-11-tetradecadien-1-ol; acetate,(e,z)-11-tetradecadien-1-yl; ferodinsl; litlurea; prodlure
(9S)-6'-methoxycinchonan-9-ol monohydrochloride 1668-99-1 360.883 (9S)-6'-methoxycinchonan-9-ol monohydrochloride
(9-OXO-4,5,6,7,8,9-HEXAHYDRO-[1,2,4]TRIAZOLO-[5,1-B]QUINAZOLIN-2-YL)-ACETIC ACID 540514-18-9 C11H12N4O3 248.24 CHEMBRDG-BB 7355804; (9-OXO-4,5,6,7,8,9-HEXAHYDRO-[1,2,4]TRIAZOLO-[5,1-B]QUINAZOLIN-2-YL)-ACETIC ACID
(9-methyl-9-azabicyclo[3.3.1]nonan-7-yl) 2-hydroxy-2,2-di(phenyl)acetate 1927-12-4 C23H27NO3 365.465 g/mol
(9H-PURIN-6-YLAMINO)ACETIC ACID 10082-93-6 C7H7N5O2 193.16 (9H-PURIN-6-YLAMINO)ACETIC ACID; IFLAB-BB F0020-0147
(9H-Fluoren-9-yl)methyl 2,4-dichloro-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate 903130-16-5 C22H17Cl2N3O2 426.29 (9H-FLUOREN-9-YL)METHYL 2,4-DICHLORO-7,8-DIHYDROPYRIDO[4,3-D]PYRIMIDINE-6(5H)-CARBOXYLATE
(9H-Fluoren-9-yl)methyl 2,4-dichloro-5H-pyrrolo[3,4-d]pyrimidine-6(7H)-carboxylate 903129-86-2 C21H15Cl2N3O2 412.27 (9H-FLUOREN-9-YL)METHYL 2,4-DICHLORO-5H-PYRROLO[3,4-D]PYRIMIDINE-6(7H)-CARBOXYLATE; 2,4-Dichloro-5H-pyrrolo[3,4-d]pyrimidine-6(7H)-carboxylate
(9-FLUORENYL)TRIPHENYLPHOSPHONIUM BROMIDE 7253-07-8 C31H24BrP 507.4 (9-FLUORENYL)TRIPHENYLPHOSPHONIUM BROMIDE; 9-Fluorenyl triphenylphosphonium bromide, 98 %
(9-ETHYL-9H-CARBAZOL-3-YLMETHYL)-HYDRAZINE 887593-22-8 C15H17N3 239.32 (9-ETHYL-9H-CARBAZOL-3-YLMETHYL)-HYDRAZINE
(6-Fluoro-4H-1,3-benzodioxin-8-yl)methanol 306934-89-4 C9H9FO3 184.16 RARECHEM AL BD 1311; (6-FLUORO-4H-1,3-BENZODIOXIN-8-YL)METHANOL; (6-FLUORO-1,3-BENZODIOXEN-8-YL)METHANOL
(6-FLUORO-1,2,3,4-TETRAHYDRO-NAPHTHALEN-2-YL)-ACETIC ACID 885269-53-4 C12H13FO2 208.23 (6-FLUORO-1,2,3,4-TETRAHYDRO-NAPHTHALEN-2-YL)-ACETIC ACID
(6-Ethylpyridin-2-yl)methanol 163658-33-1 C8H11NO 137.18 (6-ethylpyridin-2-yl)methanol; 2-Pyridinemethanol,6-ethyl-(9CI); (2-ethyl-pyridin-6-yl)methanol; 2-Pyridinemethanol, 6-ethyl
(6E,10E,14E,18E)-2,3-EPOXY-2,6,10,15,19,23-EPOXY-2,6,10,15,19,23-HEXAMETHYL-6,10,14,18,22-TETRACOSAPENTAENE 7200-26-2 C30H50O 426.72 SQUALENE EPOXIDE; (6E,10E,14E,18E)-2,3-EPOXY-2,6,10,15,19,23-EPOXY-2,6,10,15,19,23-HEXAMETHYL-6,10,14,18,22-TETRACOSAPENTAENE; 2,3-OXIDOSQUALENE; 2,3-OXIDOSQUALENE (RACEMIC); (6E,10E,14E,18E)-2,3-Epoxy-2,6,10,15,19,23-epoxy-2,6,10,15,19,23-hexamethyl-6,10
(6-Chloro-pyridin-3-yl)propan-2-one 885267-13-0 C8H8ClNO 0
(6-CHLOROPYRIDIN-3-YL)-CYCLOPROPYL-METHANONE 872088-06-7 C9H8ClNO 181.62 (6-CHLOROPYRIDIN-3-YL)-CYCLOPROPYL-METHANONE
(6-Chloropyridazin-3-yl)-methylamine 871826-15-2 C5H6ClN3 143.57 TIMTEC-BB SBB010299; ASINEX-REAG BAS 07730925; AURORA KA-268; (6-CHLORO-PYRIDAZIN-3-YL)-METHYL-AMINE; UKRORGSYN-BB BBR-044861; 1-(6-CHLOROPYRIDAZIN-3-YL)METHANAMINE
(6-CHLORO-PYRIDAZIN-3-YL)-DIMETHYL-AMINE 7145-60-0 C6H8ClN3 157.6 (6-CHLORO-PYRIDAZIN-3-YL)-DIMETHYL-AMINE; AKOS BBS-00002688; CHEMBRDG-BB 9071131; 6-chloro-N,N-dimethylpyridazin-3-amine
(6-Chloro-pyrazin-2-yl)-cyclohexyl-amine 642459-26-5 C10H14ClN3 211.7 2-Chloro-6-(cyclohexylamino)pyrazine; 6-Chloro-N-cyclohexylpyrazin-2-amine; (6-chloropyrazin-2-yl)cyclohexylamine
(6-Chloroimidazo[2,1-b][1,3]thiazol-5-yl)methanol 24918-13-6 C6H5ClN2OS 188.63 (6-CHLOROIMIDAZO[2,1-B][1,3]THIAZOL-5-YL)METHANOL; (6-CHLORO-IMIDAZO[2,1-B]THIAZOL-5-YL)-METHANOL; RARECHEM AL BD 0972
(5-Methyl-3-phenyl-4-isoxazolyl)methanol 18718-79-1 C11H11NO2 189.21 RARECHEM AL BD 0514; (5-METHYL-3-PHENYLISOXAZOL-4-YL)METHANOL; (5-METHYL-3-PHENYL-4-ISOXAZOLYL)METHANOL; BUTTPARK 154\16-51; 4-(Hydroxymethyl)-5-methyl-3-phenylisoxazole; 5-Methyl-3-phenylisoxazole-4-methanol
(5-METHYL-3-NITRO-PYRAZOL-1-YL)-ACETIC ACID 344912-39-6 C6H7N3O4 185.14 TIMTEC-BB SBB000252; AKOS B015891; (5-METHYL-3-NITRO-PYRAZOL-1-YL)-ACETIC ACID; (5-METHYL-3-NITRO-1H-PYRAZOL-1-YL)ACETIC ACID; CHEMBRDG-BB 5673496; ART-CHEM-BB B015891
(5-Methyl-1H-benzoimidazol-2-ylsulfanyl)acetic acid 27231-37-4 C10H10N2O2S 222.26 (5-METHYL-1H-BENZOIMIDAZOL-2-YLSULFANYL)-ACETIC ACID; CHEMBRDG-BB 4140363; ASINEX-REAG BAS 16289554; TIMTEC-BB SBB011493; ((5-METHYL-1H-BENZIMIDAZOL-2-YL)THIO)ACETIC ACID
(5-METHYL-1,3-BIS-TRIMETHYLSILYL)-2,4-(1H,3H-PYRIMIDINEDIONE) 3444-09-5 C11H22N2O2Si2 270.47558 (5-METHYL-1,3-BIS-TRIMETHYLSILYL)-2,4-(1H,3H-PYRIMIDINEDIONE); BIS-TRIMETHYLSILYL-THYMINE; BIS-TRIMETHYLSILYL-THYMINE (5-METHYL-1,3-BIS-TRIMETHYLSILYL-2,4-(1H,3H-PYRIMIDINEDIONE)
(5-METHYL-[1,3,4]THIADIAZOL-2-YLSULFANYL)-ACETIC ACID 50918-26-8 C5H6N2O2S2 190.24 TIMTEC-BB SBB009597; CHEMBRDG-BB 4003215; ART-CHEM-BB B022055; (5-METHYL-[1,3,4]THIADIAZOL-2-YLSULFANYL)-ACETIC ACID; [(5-METHYL-1,3,4-THIADIAZOL-2-YL)THIO]ACETIC ACID; AKOS BBS-00001857; AKOS TOT-0665; AKOS DM0114
(5-METHOXY-INDOL-3-YLETHYL)-HYDRAZINE 887593-64-8 C11H15N3O 205.26 (5-METHOXY-INDOL-3-YLETHYL)-HYDRAZINE
(4-BOC-AMINO-PIPERIDIN-1-YL)-THIOPHEN-3-YL-ACETIC ACID 885275-49-0 C16H24N2O4S 340.44 (4-BOC-AMINO-PIPERIDIN-1-YL)-THIOPHEN-3-YL-ACETIC ACID
(4-BOC-AMINO-PIPERIDIN-1-YL)-THIOPHEN-2-YL-ACETIC ACID 885275-38-7 C16H24N2O4S 340.44 (4-BOC-AMINO-PIPERIDIN-1-YL)-THIOPHEN-2-YL-ACETIC ACID
(4-BOC-AMINO-PIPERIDIN-1-YL)-PYRIDIN-4-YL-ACETIC ACID 885275-36-5 C17H25N3O4 335.4 (4-BOC-AMINO-PIPERIDIN-1-YL)-PYRIDIN-4-YL-ACETIC ACID
(4-BOC-AMINO-PIPERIDIN-1-YL)-PYRIDIN-3-YL-ACETIC ACID 885276-22-2 C17H25N3O4 335.4 (4-BOC-AMINO-PIPERIDIN-1-YL)-PYRIDIN-3-YL-ACETIC ACID
(4-BOC-AMINO-PIPERIDIN-1-YL)-P-TOLYL-ACETIC ACID 885275-57-0 C19H28N2O4 348.44 (4-BOC-AMINO-PIPERIDIN-1-YL)-P-TOLYL-ACETIC ACID
(4-BOC-AMINO-PIPERIDIN-1-YL)-NAPHTHALEN-2-YL-ACETIC ACID 885275-41-2 C22H28N2O4 384.47 (4-BOC-AMINO-PIPERIDIN-1-YL)-NAPHTHALEN-2-YL-ACETIC ACID
(4-BOC-AMINO-PIPERIDIN-1-YL)-(1H-INDOL-2-YL)-ACETIC ACID 885275-43-4 C20H27N3O4 373.45 (4-BOC-AMINO-PIPERIDIN-1-YL)-(1H-INDOL-2-YL)-ACETIC ACID
(4-BENZYL-PIPERIDIN-1-YL)-ACETIC ACID 438634-64-1 C14H19NO2 233.31 ASINEX-REAG BAS 13259261; (4-BENZYL-PIPERIDIN-1-YL)-ACETIC ACID; 2-(4-BENZYLPIPERIDIN-1-YL)ACETIC ACID; OTAVA-BB 7020661959
(4-BENZYL-PIPERAZIN-1-YL)-ACETIC ACID DIHYDROCHLORIDE 214535-51-0 C13H20Cl2N2O2 307.2161 (4-BENZYL-PIPERAZIN-1-YL)-ACETIC ACID DIHYDROCHLORIDE; (4-BENZYL-PIPERAZIN-1-YL)-ACETIC ACID 2HCL
(4-BENZYLOXY-BENZYL)-PYRIDIN-2-YLMETHYL-AMINE 680185-70-0 C20H20N2O 304.39 (4-BENZYLOXY-BENZYL)-PYRIDIN-2-YLMETHYL-AMINE
(3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(3-METHOXY-PHENYL)-ACETIC ACID 887594-48-1 C17H24N2O5 336.38 (3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(3-METHOXY-PHENYL)-ACETIC ACID; ALPHA-(3-METHOXYPHENYL)-3-(BOC-AMINO)-1-AZETIDINEACETIC ACID
(3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(3-CHLORO-PHENYL)-ACETIC ACID 887594-72-1 C16H21ClN2O4 340.8 (3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(3-CHLORO-PHENYL)-ACETIC ACID; ALPHA-(3-CHLOROPHENYL)-3-(BOC-AMINO)-1-AZETIDINEACETIC ACID
(3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(2-METHOXY-PHENYL)-ACETIC ACID 887594-52-7 C17H24N2O5 336.38 (3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(2-METHOXY-PHENYL)-ACETIC ACID; ALPHA-(2-METHOXYPHENYL)-3-(BOC-AMINO)-1-AZETIDINEACETIC ACID
(3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(2-FLUORO-PHENYL)-ACETIC ACID 887594-64-1 C16H21FN2O4 324.35 (3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(2-FLUORO-PHENYL)-ACETIC ACID; ALPHA-(2-FLUOROPHENYL)-3-(BOC-AMINO)-1-AZETIDINEACETIC ACID
(3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(2-CHLORO-PHENYL)-ACETIC ACID 887592-80-5 C16H21ClN2O4 340.8 (3-TERT-BUTOXYCARBONYLAMINO-AZETIDIN-1-YL)-(2-CHLORO-PHENYL)-ACETIC ACID; ALPHA-(2-CHLOROPHENYL)-3-(BOC-AMINO)-1-AZETIDINEACETIC ACID
(3S-CIS)-(+)-TETRAHYDRO-3,7A-DIPHENYLPYRROLO[2,1-B]OXAZOL-5(6H)-ONE 161970-71-4 C18H17NO2 279.33 (3S-CIS)-(+)-3,7A-DIPHENYLTETRAHYDROPYRROLO-[2,1-B]-OXAZOL-5(6H)-ONE; (3S-CIS)-(+)-TETRAHYDRO-3,7A-DIPHENYLPYRROLO[2,1-B]OXAZOL-5(6H)-ONE; (3S-CIS)-(+)-TETRAHYDRO-3,7A-DIPHENY-PYR ROLO(2,1-B)OXAZOL-5(6H)-ONE, 98%; Pyrrolo[2,1-b]oxazol-5(6H)-one, tetrahydr
(3S-CIS)-(+)-2,3-DIHYDRO-7A-METHYL-3-PHENYLPYRROLO[2,1-B ]OXAZOL-5(7A H)-ONE 143140-06-1 C13H13NO2 215.25 (3S-CIS)-2,3-DIHYDRO-7A-METHYL-3-PHENYLPYRROLO-[2,1-B]-OXAZOL-5(6H)-ONE; (3S-CIS)-(+)-2,3-DIHYDRO-7A-METHYL-3-PHENYLPYRROLO[2,1-B ]OXAZOL-5(7A H)-ONE; (3S-CIS)-2,3-DIHYDRO-7A-METHYL-3-PHENYLPYRROLO-[2,1-B]OXAZOL-5(7AH)-ONE; (3S-CIS)-(+)-2,3-DIHYDRO-7A-ME-
(3S,7AR)-3-T-BUTYL-7A-METHYL BICYCLIC LACTAM 98203-44-2 C10H17NO2 183.25 (3S,7AR)-3-ISOPROPYL-7A-METHYL BICYCLIC LACTAM; (3S,7AR)-3-T-BUTYL-7A-METHYL BICYCLIC LACTAM; (3S-CIS)-(+)-TETRAHYDRO-3-ISOPROPYL-7A-METHYLPYRROLO[2,1-B]OXAZOL-5(6H)-ONE; (3S-CIS)-(+)-3-ISOPROPYL-7ALPHA-METHYLTETRAHYDROPYRROLO[2,1-B]OXAZOL-5(6H)-ONE; (3S-
(3R,4R)-4-Aminotetrahydropyran-3-carboxylic acid methyl ester 503168-22-7 C7H13NO3 0 (3R,4R)-4-Aminotetrahydropyran-3-carboxylic acid methyl ester; (3R,4R)-Methyl 4-aminotetrahydro-2H-pyran-3-carboxylate
(3R,4R)-4,5-ISOPROPYLIDENE PENT-2-YN-3-OL 4957-71-5 C8H12O3 156.18 (3R,4R)-4,5-ISOPROPYLIDENE PENT-2-YN-3-OL
(3R,4R)-4,5-ISOPROPYLIDENE PENT-2-EN-3-OL 18524-18-0 C8H14O3 158.19 (3R,4R)-4,5-ISOPROPYLIDENE PENT-2-EN-3-OL; 1-((R)-2,2-DIMETHYL-1,3-DIOXOLAN-4-YL)PROP-2-EN-1-OL
(3R,4R)-3,4-pyrrolidinediol 186393-31-7 C4H9NO2 103.11976;g/mol (3R,4R)-pyrrolidine-3,4-diol;(3R,4R)-3,4-PYRROLIDINEDIOL;trans-3,4-Dihydroxypyrrolidine;186393-31-7;3,4-Pyrrolidinediol,(3R,4R)-;Ambcb4034532
(3R,4R)-3,4-Difluoropyrrolidin-1-ylethanol 871822-43-4 C6H11F2NO 151.15 (3r,4r)-3,4-difluoropyrrolidin-1-ylethanol; (3R,4R)-3,4-Difluoro-1-pyrrolidineethanol
(3R,4R)-3,4-Difluoro-1-phenylpyrrolidine 209625-77-4 C10H11F2N 183.2 (3R,4R)-3,4-DIFLUORO-1-PHENYLPYRROLIDINE
(3-Methoxy-4-tolyl)sulfamic acid 84029-44-7 C8H11NO4S 217.24224
(3-Isobutylpiperidin-3-yl)methanol 915922-54-2 C10H21NO 0 CHEMBRDG-BB 4017651; (3-ISOBUTYLPIPERIDIN-3-YL)METHANOL; 3-piperidinemethanol, 3-(2-methylpropyl)-
(3-IODOPHENOXY) ACETIC ACID ETHYL ESTER 90888-04-3 C10H11IO3 306.1 (3-IODOPHENOXY) ACETIC ACID ETHYL ESTER
(3-IODO-BENZYL)-CARBAMIC ACID TERT-BUTYL ESTER 263351-43-5 C12H16INO2 333.16541 (3-IODO-BENZYL)-CARBAMIC ACID TERT-BUTYL ESTER
(3-Hydroxypropan-1-yl-3-ylidene)trisphosphonic acid 51556-88-8 C3H11O10P3 300.034723 (3-hydroxypropan-1-yl-3-ylidene)trisphosphonic acid
(3-HYDROXY-PHENYL)-PHENYLAMINO-ACETONITRILE 904817-08-9 C14H12N2O 224.26 (3-HYDROXY-PHENYL)-PHENYLAMINO-ACETONITRILE; Anilino(3-hydroxyphenyl)acetonitrile
(3-HYDROXYPHENYL)ACETONE OXIME 319914-13-1 C9H11NO2 165.19 (3-HYDROXYPHENYL)ACETONE OXIME; 2-PROPANONE, 1-(3-HYDROXYPHENYL)-, OXIME
(3-HYDROXYPHENYL)ACETONE 64479-84-1 C9H10O2 150.17 (3-HYDROXYPHENYL)ACETONE; 1-(3-hydroxyphenyl)acetone; 1-(3-Hydroxyphenyl)-2-propanone
(9E)-Erythromycin 9-[O-[[(2-Methoxyethoxy)methoxy]methyl]oxime] 425365-64-6 C42H78N2O16 867.07 Roxithromycin impurity G;
(9b,11b,16a)-9,11-Epoxy-21-hydroxy-16-methylpregna-1,4-diene-3,20-dione 151265-33-7 C22H28O4 356.46 SCHEMBL4105973; 151265-33-7; (9b,11b,16a)-9,11-Epoxy-21-hydroxy-16-methylpregna-1,4-diene-3,20-dione; 3-Oxo-9beta,11beta-epoxy-16alpha-methyl-17beta-(2-hydroxyacetyl)androsta-1,4-diene
(9-azaniumyl-9-iminononanimidoyl)azanium dichloride 63906-97-8 C9H22Cl2N4 257.204 g/mol
(8S,2R)-Diamino nonanedioic acid 59014-27-6 C9H18N2O4 218.25022 (8S,2R)-Diaminononanedioic acid
(8S,15S)-DIHETE 80234-65-7 C20H32O4 336.47 (8S,15S)-DIHETE; (8S,15S)-DIHYDROXY-(5Z,9E,11Z,13E)-EICOSATETRAENOIC ACID; 8(S),15(S)-DIHYDROXYEICOSA-5Z,9E,11Z,13E-TETRAENOIC ACID; (8S,15S)-dihydroxy-(5Z,9E,11Z,13E)-*eicosatetraen; (8S,15S)-DIHYDROXY-(5Z,9E,11Z,13E)-EICOS ATETRAENOI
(8R,9S,10R,13S,14S,17R)-13-ethyl-17-ethynyl-17-hydroxy-1,2,6,7,8,9,10,11,12,14-decahydrocyclopenta[a]phenanthren-3-one;(8R,9S,13S,14S,17R)-17-ethynyl-13-methyl-7,8,9,11,12,14,15,16-octahydro-6H-cyclopenta[a]phenanthrene-3,17-diol 109852-02-0 C41H50O4 606.833 g/mol
(8-CYANO-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID 885275-53-6 C10H7N3O2 201.18 (8-CYANO-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID
(8-Nitro-imidazo[1,2-a]pyridin-2-yl)-acetic acid 59128-17-5 C9H7N3O4 221.17 (8-NITRO-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID
(8-methyl-8-azabicyclo[3.2.1]octan-3-yl)(2S)-3-hydroxy-2-methyl-2-phenylpropanoate hydrochloride 14641-96-4 C18H26ClNO3 339.857 g/mol
(8-Hydroxyquinolin-7-yl)methyl dibutyldithiocarbamate 87236-71-3 C19H26N2OS2
(8-CHLORO-4-OXO-1,2,3,4-TETRAHYDRO-CYCLOPENTA[C]CHROMEN-7-YLOXY)-ACETIC ACID 326102-27-6 C14H11ClO5 294.69 CHEMBRDG-BB 6237747; (8-CHLORO-4-OXO-1,2,3,4-TETRAHYDRO-CYCLOPENTA[C]CHROMEN-7-YLOXY)-ACETIC ACID; OTAVA-BB 0105810079
(8-Bromooct-1-yl)benzene 54646-75-2 C14H21Br 269.22 (8-Bromooct-1-yl)benzene; 1-Bromo-8-phenyloctane
(8-BROMO-6-CHLORO-CHROMAN-3-YL)-METHYLAMINE 885271-41-0 C10H11BrClNO 276.56 (8-BROMO-6-CHLORO-CHROMAN-3-YL)-METHYLAMINE
(8-Boc-5,6,7,8-Tetrahydro-[1,8]naphthyridin-2-yl)-acetic acid methyl ester 925889-81-2 C16H22N2O4 306.35
(8-Benzyloxy-imidazo[1,2-a]pyridin-2-yl)acetic acid 885276-83-5 C16H14N2O3 282.29 (8-BENZYLOXY-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID
(8a,9R)-Cinchonan-9-ol mono[[(S)-[(1R)-2-methyl-1-(1-oxopropoxy)propoxy](4-phenylbutyl)phosphinyl]acetate] 137590-32-0 C19H29O6P.C19H22N2O 678.8 (8a,9R)-Cinchonan-9-ol mono[[(S)-[(1R)-2-methyl-1-(1-oxopropoxy)propoxy](4-phenylbutyl)phosphinyl]acetate]
(8,9S)-10,11-Dihydro-6-methoxycinchonan-9-amine trihydrochloride 931098-91-8 434.83 (S)-((2S,4S,5R)-5-Ethylquinuclidin-2-yl)(6-methoxyquinolin-4yl)methanamine trihydrochloride, Dihydroquinine-9-epiamine
(7Z,9E)-dodeca-7,9-dienol 54364-60-2 C12H22O
(7S,8S,9S)-7,8,9,10-tetrahydrobenzo[a]pyrene-7,8,9-triol 61176-59-8 C20H16O3 304.339 g/mol
(7S)-7-phenyl-4-thia-1,6-diazabicyclo[3.3.0]oct-5-ene hydrochloride 74191-78-9 C11H13ClN2S 0 (7S)-7-phenyl-4-thia-1,6-diazabicyclo[3.3.0]oct-5-ene hydrochloride
(7S)-6,7-Dihydro-5H-cyclopenta[b]pyridin-7-ol 887921-99-5 C8H9NO 135.16 5H-cyclopenta[b]pyridin-7-ol,6,7-dihydro-,(7S)-; (7S)-6,7-Dihydro-5H-cyclopenta[b]pyridin-7-ol
(7S)-4,5,6,7-Tetrahydro-2-methyl-1H-1,3-Diazepine-7-carboxylicacid 783339-87-7
(7R,8S)-7-(dipropylamino)-8-methyl-tetralin-1-ol 64425-86-1 C17H27NO
(7R)-2-chloro-8-cyclopentyl-7-ethyl-7,8-dihydro-5-methyl-6(5H)-pteridinone 755039-55-5 C14H19ClN4O 294.78
(7R)-2-Chloro-7-ethyl-7,8-dihydro-8-(1-methylethyl)-6(5H)-pteridinone 889877-77-4 C11H15ClN4O 254.72
(7-METHYL-4-OXO-1,2,3,4-TETRAHYDRO-CYCLOPENTA[C]CHROMEN-9-YLOXY)-ACETIC ACID 307549-54-8 C15H14O5 274.27 (7-METHYL-4-OXO-1,2,3,4-TETRAHYDRO-CYCLOPENTA[C]CHROMEN-9-YLOXY)-ACETIC ACID; CHEMBRDG-BB 6151265; OTAVA-BB 7210430640
(7-METHOXY-BENZO[1,3]DIOXOL-5-YLMETHYL)-HYDRAZINE 887593-36-4 C9H12N2O3 196.2 (7-METHOXY-BENZO[1,3]DIOXOL-5-YLMETHYL)-HYDRAZINE
(7-HYDROXY-NAPHTHALEN-1-YL)-HYDRAZINE 887592-89-4 C10H10N2O 174.2 (7-HYDROXY-NAPHTHALEN-1-YL)-HYDRAZINE
(7-HYDROXY-6-METHOXY-1,2,3,4-TETRAHYDRO-ISOQUINOLIN-1-YL)-ACETIC ACID 111599-06-5 C12H15NO4 0 1-Isoquinolineacetic acid,1,2,3,4-tetrahydro-7-hydroxy-6-methoxy-
(7-HYDROXY-5-METHYL-[1,2,4]TRIAZOLO-[1,5-A]PYRIMIDIN-2-YL)-ACETIC ACID 99951-00-5 C8H8N4O3 208.17 CHEMBRDG-BB 5567063; (7-HYDROXY-5-METHYL-[1,2,4]TRIAZOLO-[1,5-A]PYRIMIDIN-2-YL)-ACETIC ACID
(7H-pyrrolo[2,3-d]pyrimidine-4-yl)methanamine HCl 935505-76-3 C7H9ClN4 184.62
(7-formyl-3-methyl-2,4,6-octatrienyl)triphenylphosphonium chloride 83803-84-3 C28H28ClOP 446.948081 (7-formyl-3-methyl-2,4,6-octatrienyl)triphenylphosphonium chloride; Einecs 280-904-1
(7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-P-TOLYL-AMINE 871266-80-7 C12H9ClN4S 276.74 (7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-P-TOLYL-AMINE
(7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)PHENYLAMINE 871266-78-3 C11H7ClN4S 262.72 (7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)PHENYLAMINE
(7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)ISOPROPYLAMINE 871266-86-3 C8H9ClN4S 228.7 (7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)ISOPROPYLAMINE
(7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-(4-METHOXYPHENYL)AMINE 871266-81-8 C12H9ClN4OS 292.74 (7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-(4-METHOXYPHENYL)AMINE
(7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-(3-TRIFLUOROMETHYLPHENYL)AMINE 871266-82-9 C12H6ClF3N4S 330.72 (7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-(3-TRIFLUOROMETHYLPHENYL)AMINE
(7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-(2,6-DIMETHYLPHENYL)AMINE 871266-79-4 C13H11ClN4S 290.77 (7-CHLOROTHIAZOLO[5,4-D]PYRIMIDIN-2-YL)-(2,6-DIMETHYLPHENYL)AMINE
(7-BROMOFLUOREN-2-YL)-HYDRAZINE 887593-02-4 C13H11BrN2 275.14 (7-BROMOFLUOREN-2-YL)-HYDRAZINE
(7AR)-7A-METHYL-2,3,7,7A-TETRAHYDRO-1H-INDENE-1,5(6H)-DIONE 17553-89-8 C10H12O2 164.2 HAJOS-PARRISH KETONE, (R)-(-)-ISOMER; (7AR)-7A-METHYL-2,3,7,7A-TETRAHYDRO-1H-INDENE-1,5(6H)-DIONE; (S)-(3-Acetyl-Triphenylphosphoranylidene)-4-Phenyl-Oxazolidin-2-One; (R)-(-)-2,3,7,7a-Tetrahydro-7a-methyl-1H-indene-1,5(6H)-dione
(6S,2Z)-6,7-ISOPROPYLIDENEDIOXY-3,7-DIMETHYL-2-OCTEN-1-OL 61262-96-2 C13H24O3 228.33 (6S,2Z)-6,7-ISOPROPYLIDENEDIOXY-3,7-DIMETHYL-2-OCTEN-1-OL; (6S,2Z)-6,7-Isopropylidenedioxy-3,7-dimethyl-2-octen-1-ol,97%
(6S)-6-Azido-6,7-dihydro-2-nitro-5H-imidazo[2,1-b][1,3]oxazine 187235-64-9 C6H6N6O3 210.15 (6S)-6-azido-2-nitro-6,7-dihydro-5H-imidazo[2,1-b][1,3]oxazine; ZINC96331722; (6S)-6-Azido-6,7-dihydro-2-nitro-5H-imidazo[2,1-b][1,3]oxazine; 187235-64-9
(6R-trans)-7-Amino-8-oxo-3-(((1-(sulphomethyl)-1H-tetrazol-5-yl)thio)methyl)-5-thia-1-azabicyclo[4.2.0]oCt-2-ene-2-carboxylic acid 61270-71-1 C10H12N6O6S3 408.44 (6r-trans)-7-amino-8-oxo-3-(((1-(sulphomethyl)-1h-tetrazol-5-yl)thio)methyl)-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid; 7-aca-3-smt; 7-Aca-3-SmtC10H12N6O6S3; (6R-TRANS)-7-AMINO-8-OXO-3-(((1-(SULPHOMETHYL)-1H-TETRAZOL-5-YL)THIO)METHYL)-5-THIA-1
(6R,7S)-2-Acetyl-2-azabicyclo[2.2.1]hept-5-en-3-one 189098-29-1 C8H9NO2 151.16 (6R,7S)-2-ACETYL-2-AZA-BICYCLO[2.2.1]HEPT-5-EN-3-ONE; 2-Azabicyclo[2.2.1]hept-5-en-3-one, 2-acetyl-, (1R,4S)- (9CI)
(6R,7R)-Benzhydryl 7-amino-3-((1-methyl-1H-tetrazol-5-ylthio)methyl)-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate 53090-86-1
(6R,7R)-3-[(4-carbamoylpyridin-1-ium-1-yl)methyl]-8-oxo-7-[(2-phenyl-2-sulfoacetyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate sodium 41444-66-0 C22H20N4O8S2.Na 555.532
(6R)-4-HYDROXY-6-PHENETHYL-6-PROPYL-5,6-DIHYDRO-2H-PYRAN-2-ONE 221129-55-1 C16H20O3 260.3282;g/mol (2R)-4-hydroxy-2-(2-phenylethyl)-2-propyl-3H-pyran-6-one; (6R)-4-HYDROXY-6-PHENETHYL-6-PROPYL-5,6-DIHYDRO-2H-PYRAN-2-ONE; 221129-55-1; SCHEMBL6702703; ZINC100134268
(6-P-TOLYLPYRIDIN-3-YL)METHANOL 887974-64-3 C13H13NO 199.25 (6-P-TOLYLPYRIDIN-3-YL)METHANOL; [6-(4-METHYLPHENYL)PYRIDIN-3-YL]METHANOL; 6-(4-METHYLPHENYL)-3-PYRIDINEMETHANOL
(6-P-TOLYL-IMIDAZO[2,1-B]THIAZOL-3-YL)-ACETIC ACID 68347-94-4 C14H12N2O2S 272.32 (6-P-TOLYL-IMIDAZO[2,1-B]THIAZOL-3-YL)-ACETIC ACID; 6-(4-METHYLPHENYL)IMIDAZO[2,1-B]THIAZOLE-3-ACETIC ACID; OTAVA-BB 7020710075
(6-PHENYL-IMIDAZO[2,1-B]THIAZOL-3-YL)-ACETIC ACID ETHYL ESTER 57626-46-7 C15H14N2O2S 286.35 (6-PHENYL-IMIDAZO[2,1-B]THIAZOL-3-YL)-ACETIC ACID ETHYL ESTER
(6-Phenyl-3-pyridinyl)methylamine 294648-38-7 C12H12N2 184.23708 (6-Phenyl-3-pyridinyl)methylamine
(6-PHENYL-3-PYRIDINYL)METHANOL 4634-09-7 C12H11NO 185.22184
(6-OXO-7,8,9,10-TETRAHYDRO-6H-BENZO[C]CHROMEN-3-YLOXY)-ACETIC ACID 325737-63-1 C15H14O5 274.27 (6-OXO-7,8,9,10-TETRAHYDRO-6H-BENZO[C]CHROMEN-3-YLOXY)-ACETIC ACID; CHEMBRDG-BB 6239018; OTAVA-BB 0105810008
(6-OXO-1,6-DIHYDRO-PYRIDAZIN-3-YLOXY)-ACETIC ACID 34173-61-0 C6H6N2O4 170.12284;g/mol 2-[(6-oxo-1H-pyridazin-3-yl)oxy]aceticacid;34173-61-0;2-((6-Oxo-1,6-dihydropyridazin-3-yl)oxy)aceticacid;(6-Oxo-1,6-dihydro-pyridazin-3-yloxy)-aceticacid;ST50984604;Aceticacid,2-[(1,6-dihydro-6-oxo-3-pyridazinyl)oxy]-
(6-O-TOLYLPYRIDIN-3-YL)METHANOL 875777-38-1 C13H13NO 199.25 [6-(2-METHYLPHENYL)PYRIDIN-3-YL]METHANOL; (6-O-TOLYLPYRIDIN-3-YL)METHANOL; 6-(2-METHYLPHENYL)-3-PYRIDINEMETHANOL
(6-MORPHOLINOPYRID-2-YL)METHYLAMINE 868755-52-6 C10H15N3O 193.25 (6-MORPHOLINOPYRID-2-YL)METHYLAMINE; (6-MORPHOLINOPYRIDIN-2-YL)METHYLAMINE; 1-(6-Morpholin-4-ylpyridin-2-yl)methylamine; 2-(Aminomethyl)-6-(morpholin-4-yl)pyridine 95%; 2-(Aminomethyl)-6-(morpholin-4-yl)pyridine
(6-METHYL-PYRIDIN-2-YLOXY)-ACETIC ACID ETHYL ESTER 91012-57-6 C10H13NO3 195.21512 (6-METHYL-PYRIDIN-2-YLOXY)-ACETIC ACID ETHYL ESTER
(6-METHYL-PYRIDIN-2-YLMETHYL)-HYDRAZINE 887592-56-5 C7H11N3 137.18 (6-METHYL-PYRIDIN-2-YLMETHYL)-HYDRAZINE
(6-Methylpyridin-2-yl)methyl acetate 13287-64-4 C9H11NO2 165.19 (6-methylpyridin-2-yl)methylacetate; 13287-64-4; NSC155723; AC1L6F79; SCHEMBL1558091; 2-acetoxymethyl-6-methylpyridine
(6-Methyl-imidazo[1,2-a]pyridin-2-yl)-acetic acid 59128-10-8 C10H10N2O2 190.2 (6-METHYL-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID
(6-METHYL-4-OXO-1,2,3,4-TETRAHYDRO-CYCLOPENTA[C]CHROMEN-7-YLOXY)-ACETIC ACID 314743-72-1 C15H14O5 274.27 AURORA 16242; CHEMBRDG-BB 6135726; (6-METHYL-4-OXO-1,2,3,4-TETRAHYDRO-CYCLOPENTA[C]CHROMEN-7-YLOXY)-ACETIC ACID; OTAVA-BB BB7210430501; AKOS BBS-00008719; OTAVA-BB 7210430501
(6-METHYL-2-P-TOLYL-IMIDAZO[1,2-A]PYRIDIN-3-YL)-ACETIC ACID ETHYL ESTER 193979-47-4 C19H20N2O2 308.37 (6-METHYL-2-P-TOLYL-IMIDAZO[1,2-A]PYRIDIN-3-YL)-ACETIC ACID ETHYL ESTER
(6-METHYL-2-PHENYL-IMIDAZO[1,2-A]PYRIDIN-3-YL)-ACETONITRILE 885272-76-4 C16H13N3 247.29 (6-METHYL-2-PHENYL-IMIDAZO[1,2-A]PYRIDIN-3-YL)-ACETONITRILE
(6-METHYL-2-PHENYL-IMIDAZO[1,2-A]PYRIDIN-3-YL)-ACETIC ACID 365213-66-7 C16H14N2O2 266.29 (6-METHYL-2-PHENYL-IMIDAZO[1,2-A]PYRIDIN-3-YL)-ACETIC ACID
(6-methoxypyridin-2-yl)methanamine 194658-13-4 C7H10N2O 138.17 (6-methoxypyridin-2-yl)methanamine; 2-Pyridinemethanamine,6-methoxy-(9CI); 6-Methoxy-2-pyridinemethanamine; 2-Pyridinemethanamine, 6-methoxy
(6-METHOXY-INDOL-3-YLETHYL)-HYDRAZINE 887593-67-1 C11H15N3O 205.26 (6-METHOXY-INDOL-3-YLETHYL)-HYDRAZINE
(6-METHOXY-CHROMAN-3-YL)-METHYLAMINE 203987-26-2 C11H15NO2 193.24 (6-METHOXY-CHROMAN-3-YL)-METHYLAMINE
(6-METHOXY-2-OXO-2,3-DIHYDRO-1H-INDOL-3-YL)-ACETIC ACID 885272-28-6 C11H11NO4 221.21 CHEMBRDG-BB 4402029; (6-METHOXY-2-OXO-2,3-DIHYDRO-1H-INDOL-3-YL)-ACETIC ACID
(6-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)-nonylazanium chloride 67510-77-4 C20H34ClNO 339.943 g/mol
(6-Fluorobenzo[d]thiazol-2-yl)methanol 197364-68-4 C8H6FNOS 183.202743;g/mol (6-fluoro-1,3-benzothiazol-2-yl)methanol;(6-Fluorobenzo[d]thiazol-2-yl)methanol;197364-68-4;SCHEMBL7547176;CTK8C2982;JFMAENBYNXKRTD-UHFFFAOYSA-N
(6-FLUORO-4H-1,3-BENZODIOXIN-8-YL)METHYLAMINE HYDROCHLORIDE 859833-12-8 C9H11ClFNO2 219.64 (6-FLUORO-4H-1,3-BENZODIOXIN-8-YL)METHYLAMINE HYDROCHLORIDE
(6-Fluoro-4H-1,3-benzodioxin-8-yl)methylamine 306934-88-3 C9H10FNO2 183.181 (6-fluoro-4H-1,3-benzodioxin-8-yl)methylamine; 306934-88-3; 4H-1,3-Benzodioxin-8-methanamine,6-fluoro-; (6-Fluoro-2,4-Dihydro-1,3-Benzodioxin-8-Yl)Methanamine; 1-(6-fluoro-4H-1,3-benzodioxin-8-yl)methanamine; METHYLAMINE,97
(6-CHLORO-IMIDAZO[1,2-A]PYRIDIN-2-YLMETHYL)-METHYL-AMINE DIHYDROCHLORIDE 554407-29-3 C9H12Cl3N3 268.57 (6-CHLORO-IMIDAZO[1,2-A]PYRIDIN-2-YLMETHYL)-METHYL-AMINE DIHYDROCHLORIDE; (6-CHLORO-IMIDAZO[1,2-A]PYRIDIN-2-YLMETHYL)-METHYL-AMINE HYDROCHLORIDE
(6-CHLORO-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID 59128-13-1 C9H7ClN2O2 210.62 (6-CHLORO-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID; 2-(6-CHLOROIMIDAZO[1,2-A]PYRIDIN-2-YL)ACETIC ACID
(6-Chloro-chroman-3-yl)-methylamine 885271-38-5 C10H12ClNO 197.66 (6-CHLORO-CHROMAN-3-YL)-METHYLAMINE
(6-Bromo-1,3-benzodioxol-5-yl)methanol 6642-34-8 C8H7BrO3 231.04 RARECHEM AL BD 0271; (6-BROMO-BENZO[1,3]DIOXOL-5-YL)-METHANOL; (6-BROMO-1,3-BENZODIOXOL-5-YL)METHANOL
(6-Benzyloxy-1H-indazol-3-yl)acetic acid 885272-16-2 C16H14N2O3 282.29 (6-BENZYLOXY-1H-INDAZOL-3-YL)-ACETIC ACID
(6-Benzyl-5,6,7,8-tetrahydro-1,6-naphthyridin-2-yl)methanamine HCl 1187830-89-2 C9H11BrClNO2S 312.61
(6-Benzhydryloxycarbonylamino-purin-9-yl)-acetic acid 186046-80-0 C21H17N5O4 403.39 (6-BENZHYDRYLOXYCARBONYLAMINO-PURIN-9-YL)-ACETIC ACID; (6-Benzhydryloxycarbonylamino-purin-9-yl)-acetic
(6aR,9R)-7-Methyl-4,6,6a,7,8,9-hexa hydro-indolo[4,3-fg]quinoline-9-carboxylic acid hydrazide 5256-60-0
(6aR,10aS)-10a-(4-chlorophenylsulfonyl)-1,4-difluoro-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-8(9H)-one 944945-07-7
(6AR,10AR)-1-(TERT-BUTYL-DIMETHYL-SILANYLOXY)-3-(1,1-DIMETHYL-HEPTYL)-6,6-DIMETHYL-6A,7,10,10A-TETRAHYDRO-6H-BENZO[C]CHROMENE-9-CARBALDEHYDE 137945-57-4 C31H50O3Si 498.8124 (6AR,10AR)-1-(TERT-BUTYL-DIMETHYL-SILANYLOXY)-3-(1,1-DIMETHYL-HEPTYL)-6,6-DIMETHYL-6A,7,10,10A-TETRAHYDRO-6H-BENZO[C]CHROMENE-9-CARBALDEHYDE
(6a,11b,16a,17a)-6,9-Difluoro-11,17-dihydroxy-16-methyl-3-oxoandrosta-1,4-diene-17-carboxylic acid methyl ester 28416-84-4 C22H28F2O5 410.45 hydrochloricacid; hydrogenchloride; Muriaticacid; 7647-01-0; Chlorohydricacid; Acidechlorhydrique
(6-CHLORO-4-METHYL-2-OXO-2H-CHROMEN-7-YLOXY)-ACETIC ACID 326102-48-1 C12H9ClO5 268.65 (6-CHLORO-4-METHYL-2-OXO-2H-CHROMEN-7-YLOXY)-ACETIC ACID; CHEMBRDG-BB 6238415; OTAVA-BB 0105980016
(6-Chloro-4-iodo-3-pyridinyl)-carbamic acid 1,1-dimethylethyl ester 400777-00-6 C10H12ClIN2O2 354.57195;g/mol tert-butylN-(6-chloro-4-iodopyridin-3-yl)carbamate;400777-00-6;tert-Butyl(6-chloro-4-iodopyridin-3-yl)carbamate;TERT-BUTYL6-CHLORO-4-IODOPYRIDIN-3-YLCARBAMATE;(6-chloro-4-iodo-pyridin-3-yl)-carbamicacidtert-butylester;SCHEMBL1581324
(6-CHLORO-4-ETHYL-2-OXO-2H-CHROMEN-7-YLOXY)-ACETIC ACID 690682-01-0 C13H11ClO5 282.68 (6-CHLORO-4-ETHYL-2-OXO-2H-CHROMEN-7-YLOXY)-ACETIC ACID; CHEMBRDG-BB 7107281; OTAVA-BB 1090057
(6-CHLORO-2-OXO-1,2-DIHYDRO-PYRIDIN-4-YL)-ACETIC ACID METHYL ESTER 182276-20-6 C8H8ClNO3 201.61 (6-CHLORO-2-OXO-1,2-DIHYDRO-PYRIDIN-4-YL)-ACETIC ACID METHYL ESTER
(6-Chloro-1H-indol-2-yl)methanol ,98% 53590-58-2 C9H8ClNO 181.62
(6-CHLORO-1H-INDAZOL-3-YL)-ACETIC ACID 35715-85-6 C9H7ClN2O2
(6-BROMO-IMIDAZO[1,2-A]PYRIDIN-2-YLMETHYL)-METHYL-AMINE 886364-56-3 C9H10BrN3 240.1 (6-BROMO-IMIDAZO[1,2-A]PYRIDIN-2-YLMETHYL)-METHYL-AMINE
(6-BROMOIMIDAZO[1,2-A]PYRIDIN-2-YL)METHANOL 136117-71-0 C8H7BrN2O 0 (6-BROMOIMIDAZO[1,2-A]PYRIDIN-2-YL)METHANOL
(6-Bromo-imidazo[1,2-a]pyridin-2-yl)-acetic acid 59128-15-3 C9H7BrN2O2 255.07 (6-BROMO-IMIDAZO[1,2-A]PYRIDIN-2-YL)-ACETIC ACID; Nsc296228
(6-BROMO-HEXYL)-DIETHYL-AMINE 74509-66-3 C10H22BrN 236.19238 (6-BROMO-HEXYL)-DIETHYL-AMINE
(6-BROMO-8-METHOXY-CHROMAN-3-YL)-METHYLAMINE 885271-56-7 C11H14BrNO2 272.14 (6-BROMO-8-METHOXY-CHROMAN-3-YL)-METHYLAMINE
(6-Bromo-3H-imidazo[4,5-b]pyridin-2-yl)methanol 172648-19-0 C7H6BrN3O 228.04604 (6-bromo-3H-imidazo[4,5-b]pyridin-2-yl)methanol
(6-BROMO-2-METHYL-QUINOLIN-4-YL)-METHANOL 885279-63-0 C11H10BrNO 252.11 (6-BROMO-2-METHYL-QUINOLIN-4-YL)-METHANOL
(6-BROMO-2-METHOXY-1-NAPHTHYL)ACETIC ACID 329269-13-8 C13H11BrO3 295.13 IFLAB-BB F0848-0240; CHEMBRDG-BB 4401378; AKOS BBS-00000011; (6-BROMO-2-METHOXY-1-NAPHTHYL)ACETIC ACID; RARECHEM AL BO 0987; AKOS A0602-0082
(6-bromo-2,3-difluorophenyl)-Boronic acid 870718-10-8 C6H4BBrF2O2 236.81
(5E)-5-(1,3-Benzodioxol-5-ylmethylene)-2-mercapto-1,3-thiazol-4(5H)-one 28824-66-0 C11H7NO3S2 265.31 ART-CHEM-BB B018368; CHEMBRDG-BB 3018368; AKOS B018368; (5E)-5-(1,3-benzodioxol-5-ylmethylene)-2-mercapto-1,3-thiazol-4(5H)-one; Nsc31059
(5E)-3-ETHYL-5-(3-[(Z)-(3-ETHYL-1,3-BENZOTHIAZOL-2(3H)-YLIDENE)METHYL]CYCLOHEX-2-EN-1-YLIDENE)-2-THIOXO-1,3-THIAZOLIDIN-4-ONE 54118-07-9 C21H22N2OS3 414.61 4-THIAZOLIDINONE, 3-ETHYL-5-[3-[(3-ETHYL-2(3H)-BENZOTHIAZOLYLIDENE)METHYL]-2-CYCLOHEXEN-1-YLIDENE]-2-THIOXO-; (5E)-3-ETHYL-5-(3-[(Z)-(3-ETHYL-1,3-BENZOTHIAZOL-2(3H)-YLIDENE)METHYL]CYCLOHEX-2-EN-1-YLIDENE)-2-THIOXO-1,3-THIAZOLIDIN-4-ONE
(5E)-3-(2-methylphenyl)-2-sulfanylidene-5-(thiophen-2-ylmethylidene)thiazolidin-4-one 5634-53-7 C15H11NOS3 317.44894;g/mol 5634-53-7;AC1LOYER;CBMicro_026781;CTK1H4668;(5E)-3-(2-methylphenyl)-2-sulfanylidene-5-(thiophen-2-ylmethylidene)thiazolidin-4-one;MCULE-4078580908
(5E)-2-Mercapto-5-[4-(methylthio)benzylidene]-1,3-thiazol-4(5H)-one 127378-28-3 C11H9NOS3 267.39 AKOS B018340; CHEMBRDG-BB 3018340; ART-CHEM-BB B018340; (5E)-2-mercapto-5-[4-(methylthio)benzylidene]-1,3-thiazol-4(5H)-one; Albb-009160
(5E)-2-Mercapto-5-[(5-methyl-2-furyl)methylene]-1,3-thiazol-4(5H)-one 88674-82-2 C9H7NO2S2 225.29 ART-CHEM-BB B015833; CHEMBRDG-BB 3015833; (5E)-2-mercapto-5-[(5-methyl-2-furyl)methylene]-1,3-thiazol-4(5H)-one; Albb-009184
(5E)-2-Mercapto-5-(mesitylmethylene)-1,3-thiazol-4(5H)-one 153567-97-6 C13H13NOS2 263.38 ART-CHEM-BB B018352; CHEMBRDG-BB 3018352; AKOS B018352; (5E)-2-mercapto-5-(mesitylmethylene)-1,3-thiazol-4(5H)-one; Albb-009179
(5E)-2-Mercapto-5-(4-methylbenzylidene)-1,3-thiazol-4(5H)-one 33992-80-2 C11H9NOS2 235.33 AKOS B018339; CHEMBRDG-BB 3018339; ART-CHEM-BB B018339; (5E)-2-mercapto-5-(4-methylbenzylidene)-1,3-thiazol-4(5H)-one; Albb-009123
(5E)-2-Mercapto-5-(4-methoxybenzylidene)-1,3-thiazol-4(5H)-one 81154-16-7 C11H9NO2S2 251.32 ART-CHEM-BB B018328; CHEMBRDG-BB 3018328; AKOS B018328; (5E)-2-mercapto-5-(4-methoxybenzylidene)-1,3-thiazol-4(5H)-one; Albb-009125
(5-(Pyridin-4-yl)-1,3,4-oxadiazol-2-yl)methanamine 803603-49-8 C8H8N4O 176.18
(5-(4-ISOBUTYLPHENYL)ISOXAZOL-3-YL)METHANOL 763109-44-0 C14H17NO2 231.29 SALOR-INT L482749-1EA; (5-(4-ISOBUTYLPHENYL)ISOXAZOL-3-YL)METHANOL; (5-(4-ISOBUTYLPHENYL)-3-ISOXAZOLYL)METHANOL
(5-(4-CHLOROPHENYL)-1,2,4-OXADIAZOL-3-YL)METHANOL 685123-47-1 C9H7ClN2O2 210.61708 (5-(4-CHLOROPHENYL)-1,2,4-OXADIAZOL-3-YL)METHANOL
(5-(4-Bromophenyl)isoxazol-3-yl)methanol 640291-96-9 C10H8BrNO2 254.08 SALOR-INT L482722-1EA; (5-(4-BROMOPHENYL)ISOXAZOL-3-YL)METHANOL; 5-(4-BROMOPHENYL)-3-ISOXAZOLEMETHANOL
(5-(3-CHLOROPHENYL)-1,2,4-OXADIAZOL-3-YL)METHANOL 660417-36-7 C9H7ClN2O2 210.61708 (5-(3-CHLOROPHENYL)-1,2,4-OXADIAZOL-3-YL)METHANOL
(5-(3-(5-(Piperidin-1-ylmethyl)-1H-indol-2-yl)-1H-indazol-6-yl)-1H-1,2,3-triazol-4-yl)methanol 916767-35-6 C24H25N7O 427.50
(5-(2-fluorophenyl)-1-pentylpyrrol-3-yl)-naphthalen-1-ylmethanone 914458-26-7
(5-(2,4-Dichlorophenyl)oxazol-4-yl)methanol 957062-73-6 C10H7Cl2NO2 0 (5-(2,4-Dichlorophenyl)oxazol-4-yl)methanol; 5-(2,4-Dichlorophenyl)-4-hydroxymethyloxazole; [5-(2,4-Dichlorophenyl)-1,3-oxazol-4-yl]methanol; 5-(2,4-Dichlorophenyl)-4-(hydroxymethyl)-1,3-oxazole
(5-(2,4-DICHLOROPHENYL)ISOXAZOL-3-YL)METHANOL 925007-08-5 C10H7Cl2NO2 244.07 (5-(2,4-DICHLOROPHENYL)ISOXAZOL-3-YL)METHANOL
(5-(2,3-DIHYDROBENZO[B][1,4]DIOXIN-7-YL)ISOXAZOL-3-YL)METHANOL 763109-37-1 C12H11NO4 233.22 SALOR-INT L482757-1EA; (5-(2,3-DIHYDROBENZO[B][1,4]DIOXIN-7-YL)ISOXAZOL-3-YL)METHANOL; (5-(2,3-DIHYDRO-1,4-BENZODIOXIN-6-YL)-3-ISOXAZOLYL)METHANOL
(4-Cbz-Aminophenyl)boronic acid 192804-36-7 C14H14BNO4 271.08 (4-Cbz-Aminophenyl)boronic acid; 4-Benzyloxy carbonylamino-benzeneboronic acid
(4-Carboxybenzyl)methylbicarbamic acid dibenzyl ester 18969-60-3 C25H24N2O6 448.47 4-[[[methyl(phenylmethoxycarbonyl)amino]-phenylmethoxycarbonylamino]methyl]benzoicacid; SCHEMBL11872301; CTK8H4112; ZINC35567268; AKOS015967624
(4-CARBAMOYL-PIPERIDIN-1-YL)-ACETIC ACID 40479-21-8 C8H14N2O3 186.21 CHEMBRDG-BB 4013613; (4-CARBAMOYL-PIPERIDIN-1-YL)-ACETIC ACID; [4-(AMINOCARBONYL)PIPERIDIN-1-YL]ACETIC ACID; OTAVA-BB 7020661081; UKRORGSYN-BB BBR-026274
(4-CARBAMIMIDOYL-NAPHTHALEN-1-YL)-CARBAMIC ACID TERT-BUTYL ESTER 885270-07-5 C16H19N3O2 285.34 1-N-BOC-AMINO-4-CARBAMIMIDOYL-NAPHTHALENE; (4-CARBAMIMIDOYL-NAPHTHALEN-1-YL)-CARBAMIC ACID TERT-BUTYL ESTER
(4-BUTYLCYCLOHEXY)BENZENE 37909-94-7 C16H24 0 (4-butylcyclohexyl)benzene;(4-BUTYLCYCLOHEXYL)BENZENE;61203-95-0;TRANS-1-BUTYL-4-PHENYLCYCLOHEXANE;37909-94-7;PubChem2519
(4-bromothiophen-2-yl)methanamine hydrochloride 479090-38-5 C5H6BrNS 192.08 4-BROMOTHIOPHEN-2-YLMETHYLAMINE; (4-bromothiophen-2-yl)methanamine hydrochloride; 4-Bromo-2-aminomethylthiophene
(4-Bromo-thiophen-2-yl)-acetonitrile 160005-43-6 C6H4BrNS 202.07166 (4-Bromo-thiophen-2-yl)-acetonitrile
(4-Bromothiazol-5-yl)methanol 262444-15-5 C4H4BrNOS 194.04966;g/mol (4-Bromothiazol-5-yl)methanol; 262444-15-5; (4-bromo-1,3-thiazol-5-yl)methanol; 5-Thiazolemethanol,4-bromo-; SCHEMBL2558494; CTK8B5662
(4-BROMO-PHENYL)-OXO-ACETALDEHYDE 5195-29-9 C8H5BrO2 213.03 (4-BROMO-PHENYL)-OXO-ACETALDEHYDE
(4-bromophenyl)-di-p-tolylamine 58047-42-0 C20H18BrN 352.27 (4-Bromo-phenyl)-di-p-tolyl-amine; 4-BROMO-4'',4''-DIMETHYLTRIPHENYLAMINE; 4-BROMO-4'',4''-DIMETHYLTRIPHENYLAMINE,95.0+%(GC); 4-Bromo-N,N-di-p-tolylaniline
(4-BROMOPHENYL)DIPHENYLSULFONIUM TRIFLATE 255056-44-1 C19H14BrF3O3S2 491.34 DIPHENYL(4-BROMOPHENYL)SULFONIUM TRIFLATE; DIPHENYL(4-BROMOPHENYL)SULPHONIUM TRIFLATE; (4-BROMOPHENYL)DIPHENYLSULFONIUM TRIFLATE; (4-BROMOPHENYL)DIPHENYLSULFONIUM TRIFLUOROMETHANESULFONATE; (4-BROMOPHENYL)DIPHENYLSULFONIUM TRIFLAT
(4-Bromophenyl)cyclopropylmethanone 6952-89-2 C10H9OBr 225.08 4-BROMOPHENYL CYCLOPROPYL KETONE; (4-BROMOPHENYL)(CYCLOPROPYL)METHANONE; TIMTEC-BB SBB005772; (4-Bromophenyl)cyclopropylmethanone,95%
(4-BROMOPHENYL)ACETONE OXIME 103675-99-6 C9H10BrNO 228.09 (4-BROMOPHENYL)ACETONE OXIME; 2-PROPANONE, 1-(4-BROMOPHENYL)-, OXIME
(3S,4AS,8AS)-2-CARBOBENZYLOXY-DECAHYDRO-N-(2-HYDROXY-1,1-DIMETHYLETHYL)-3-ISOQUINOLINECARBOXAMIDE 213135-53-6 C22H32N2O4 388.50048 (3S,4AS,8AS)-2-CARBOBENZYLOXY-DECAHYDRO-N-(2-HYDROXY-1,1-DIMETHYLETHYL)-3-ISOQUINOLINECARBOXAMIDE
(3S,4aS,8aS)-2-[(2R,3R)-3-[(3-Amino-2-hydroxy-4-phenythiobutyl]-decahydro-N-(2-hydroxy-1,1-dimethylethyl)-3-isoquinolinecarboxamide 252186-41-7 C24H39N3O3S 0 (3S,4aS,8aS)-2-[(2R,3R)-3-[(3-Amino-2-hydroxy-4-phenythiobutyl]-decahydro-N-(2-hydroxy-1,1-dimethylethyl)-3-isoquinolinecarboxamide
(3S,3aS,6S)-3-(tert-Butyldimethylsilyloxy)-6-(hydroxymethyl)-3a,6-dimethyldecahydro-1H-cyclopenta[a]naphthalen-7(2H)-on 327048-93-1 C22H40O3Si 380.64 (3S,3AS,6S)-3-(TERT-BUTYLDIMETHYLSILYLOXY)-6-(HYDROXYMETHYL)-3A,6-DIMETHYLDECAHYDRO-1H-CYCLOPENTA[A]NAPHTHALEN-7(2H)-ON; (3S,3aS,6S)-3-(tert-Butyldimethylsilyloxy)-6-(hydroxymethyl)-3a,6-dimethyldecahydro-1H-cyclopenta[a]naphthalen-7(2H)-one
(3S,10S,13R,14S,17R)-3,14-dihydroxy-13-methyl-17-(6-oxopyran-3-yl)-1,2,3,6,7,8,9,11,12,15,16,17-dodecahydrocyclopenta[a]phenanthrene-10-carbaldehyde 510-62-3 C24H30O5 398.492 g/mol
(3S,10S,13R,14S)-3,14-dihydroxy-13-methyl-17-(5-oxo-2H-furan-3-yl)-1,2,3,4,7,8,9,11,12,15,16,17-dodecahydrocyclopenta[a]phenanthrene-10-carbaldehyde 546-04-3 C23H30O5 386.481 g/mol
(3S,10S,13R,14R,17R)-4,4,10,13,14-pentamethyl-17-[(2R)-6-methylheptan-2-yl]-2,3,5,6,7,11,12,15,16,17-decahydro-1H-cyclopenta[a]phenanthren-3-ol 79-62-9 C30H52O 428.733 g/mol
(3S)-N-Cbz-3-Mercapto-1-pyrrolidine 130516-23-3 C12H15NO2S 237.318;g/mol benzyl(3S)-3-sulfanylpyrrolidine-1-carboxylate; (S)-3-Mercapto-pyrrolidine-1-carboxylicacidbenzylester; 130516-23-3; MolPort-023-288-207; ZINC79437003; AKOS017344710
(3S)-N,1-Dimethylpiperidine-3-carboxamide 310455-02-8 C8H16N2O 156.22544;g/mol (3S)-N,1-Dimethylpiperidine-3-carboxamide; (3S)-N,N-Dimethy-3-piperidinecarboxamide
(3S)-3-METHYL-1,4-BENZODIAZEPINE-2,5-DIONE 104873-98-5 C10H10N2O2 190.2 (3S)-3-METHYL-1,4-BENZODIAZEPINE-2,5-DIONE
(3S)-3-Mercapto-(4-nitrophenyl)methyl ester-1-pyrrolidine carboxylic acid 87657-41-8 C12H14N2O4S 282.31600
(6a,11b,16a)-6,9-Difluoro-11-hydroxy-16-methylandrosta-1,4-diene-3,17-dione 25256-97-7 C20H24F2O3 350.40 (6S,8S,9R,10S,11S,13S,14S,16R)-6,9-difluoro-11-hydroxy-10,13,16-trimethyl-6,7,8,11,12,14,15,16-octahydrocyclopenta[a]phenanthrene-3,17-dione; (6a,11b,16a)-6,9-Difluoro-11-hydroxy-16-methylandrosta-1,4-diene-3,17-dione; 6alpha,9-Difluoro-11beta-hydroxy-16a
(6-2-[2-(4-Fluoro-phenyl)-4-(2-hydroxy-phenylcarbamoyl)-5-isopropyl-3-phenyl-D5-pyrrol-1-yl]-ethyl-2,2-dimethyl-[1,3]-dioxane-4-yl)-acetic Acid, tert-Butyl Ester 265989-42-2 C40H42D5FN2O6 675.84019209 (6-2-[2-(4-Fluoro-phenyl)-4-(2-hydroxy-phenylcarbamoyl)-5-isopropyl-3-phenyl-D5-pyrrol-1-yl]-ethyl-2,2-dimethyl-[1,3]-dioxane-4-yl)-acetic Acid, tert-Butyl Ester
(6-{2-[3-(4-Benzyloxy-phenylcarbamoyl)-5-(4-fluoro-phenyl)-2-isopropyl-4-phenyl-d5-pyrrol-1-yl]-ethyl}-2,2-dimethyl-[1,3]-dioxane-4-yl)-acetic acid, tert-butyl ester 265989-37-5 C47H48D5FN2O6 765.96273209 (6-2-[3-(4-Benzyloxy-phenylcarbamoyl)-5-(4-fluoro-phenyl)-2-isopropyl-4-phenyl-D5-pyrrol-1-yl]-ethyl-2,2-dimethyl-[1,3]-dioxane-4-yl)-acetic Acid, tert-Butyl Ester
(6-[4-(TRIMETHYLSILYL)PHENYL]PYRIDIN-3-YL)METHANOL 887974-60-9 C15H19NOSi 257.4 (6-[4-(TRIMETHYLSILYL)PHENYL]PYRIDIN-3-YL)METHANOL; 6-[4-(TRIMETHYLSILYL)PHENYL]-3-PYRIDINEMETHANOL
(6-[3-(TRIFLUOROMETHOXY)PHENYL]PYRIDIN-3-YL)METHANOL 197847-92-0 C13H10F3NO2 269.22 (6-[3-(TRIFLUOROMETHOXY)PHENYL]PYRIDIN-3-YL)METHANOL; 6-[3-(TRIFLUOROMETHOXY)PHENYL]-3-PYRIDINEMETHANOL
(6,8-DICHLORO-CHROMAN-3-YL)-METHYLAMINE 885271-44-3 C10H11Cl2NO 232.11 (6,8-DICHLORO-CHROMAN-3-YL)-METHYLAMINE
(6,8-DIBROMO-CHROMAN-3-YL)-METHYLAMINE 885271-59-0 C10H11Br2NO 321.01 (6,8-DIBROMO-CHROMAN-3-YL)-METHYLAMINE
(6,7-Dimethyl-2-oxo-2,3-dihydro-1H-indol-3-yl)acetic acid 915921-16-3 C12H13NO3 0 CHEMBRDG-BB 4003763; (6,7-Dimethyl-2-oxo-2,3-dihydro-1H-indol-3-yl)-acetic acid; ALINDA 14611
(6,7-Dimethoxy-1,2,3,4-tetrahydro-isoquinolin-3-yl)-methanol hydrochloride 886997-74-6 C12H18ClNO3 259.73
(6,6-DIMETHYL-4-OXO-2-PHENYL-4,5,6,7-TETRAHYDRO-INDOL-1-YL)-ACETIC ACID 121626-22-0 C18H19NO3 297.35 TIMTEC-BB SBB007351; (6,6-DIMETHYL-4-OXO-2-PHENYL-4,5,6,7-TETRAHYDRO-INDOL-1-YL)-ACETIC ACID; (6,6-Dimethyl-4-oxo-2-phenyl-4,5,6,7-tetrahydro-indol-yl)-acetic acid
(6-(pyrrolidin-1-yl)imidazo[1,2-b]pyridazin-2-yl)methanol 1184918-02-2
(6-(Benzyloxy)-1H-indazol-3-yl)methanamine 885271-08-9 C15H15N3O 253.3 C-(6-BENZYLOXY-1H-INDAZOL-3-YL)-METHYLAMINE
(5Z)-5-Hexadecenoic acid 7056-90-8 C16H30O2 254.40800
(5Z)-5-(3-ETHOXY-2-HYDROXYBENZYLIDENE)-3-METHYL-2-THIOXO-1,3-THIAZOLIDIN-4-ONE 95% 402932-19-8 295.3817
(5-TERT-BUTYL-2-HYDROXYPHENYL)(1-PHENYL-1H-PYRAZOL-4-YL)METHANONE 288844-46-2 C20H20N2O2 320.39 4-(5-TERT-BUTYL-2-HYDROXYBENZOYL)-1-PHENYLPYRAZOLE; (5-TERT-BUTYL-2-HYDROXYPHENYL)(1-PHENYL-1H-PYRAZOL-4-YL)METHANONE
(5S)-N-(tert-Butoxycarbonyl)-3,4,5,6-tetrahydro-5-phenyl-4(H)-1,4-oxazin-2-one 220077-24-7 C15H19NO4 277.32 (5S)-N-(TERT-BUTOXYCARBONYL)-3,4,5,6-TETRAHYDRO-5-PHENYL-4(H)-1,4-OXAZIN-2-ONE; (5S)-N-TERT BUTYLOXYCARBONYL-3,4,5,6-TETRAHYDRO-5-PHENYL-4(H)-1,4-OXAZIN-2-ONE
(5S)-5,7-BIS-[(TERT-BUTYLDIMETHYLSILYL)OXY]-4,4-DIMETHYLHEPTAN-3-ONE 187527-25-9 C21H46O3Si2 402.76 (5S)-5,7-BIS-[(TERT-BUTYLDIMETHYLSILYL)OXY]-4,4-DIMETHYLHEPTAN-3-ONE
(5S)-5,6-Dihydro-dT CEP 113901-09-0 C40H51N4O8P 746.83
(5S)-3,4,5,6-TETRAHYDRO-5-PHENYL-N-(BENZYLOXYCARBONYL)-4(H)-1,4-OXAZIN-2-ONE 147700-91-2 C18H17NO4 311.33 (5S)-3,4,5,6-TETRAHYDRO-5-PHENYL-N-(BENZYLOXYCARBONYL)-4(H)-1,4-OXAZIN-2-ONE
(5S)-2,2,3-trimethyl-5-phenylmethyl-4-imidazolidinone monohydrochloride 278173-23-2 C13H18N2O.HCl 254.76 (5S)-5-benzyl-2,2,3-trimethylimidazolidin-4-one; hydrochloride; 278173-23-2; (5S)-(-)-2,2,3-Trimethyl-5-benzyl-4-imidazolidinonemonohydrochloride; UNII-785PBY3X4M; (S)-5-benzyl-2,2,3-trimethylimidazolidin-4-onehydrochloride
(5R,8R,9S,10S,13S,14S,17S)-17-(2-hydroxyacetyl)-10,13-dimethyl-1,2,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydrocyclopenta[a]phenanthren-3-one 303-01-5 C21H32O3 332.477 g/mol
(5R,6S)-5,6-diphenylmorpholin-2-one 815582-48-0 C16H16ClNO2 289.75700
(5R,6S)-4-Nitrobenzyl-3-[(2-aminoethyl)thio]-6-[(1R)-1-hydroxyethyl]-1-azabicyclo[3.2.0]hept-2-ene-7-one-2-carboxylate hydrochloride 442847-69-0 C18H21N3O6S.HCl 443.91 (5R,6S)-4-Nitrobenzyl-3-[(2-aminoethyl)thio]-6-[(1R)-1-hydroxyethyl]-1-azabicyclo[3.2.0]hept-2-ene-7-one-2-carboxylate hydrochloride; Protected thiencin hydrochloride
(5R,6S)-2-Mesityl-5,6-diphenyl-6,8-dihydro-5H-[1,2,4]triazolo[3,4-c][1,4]oxazin-2-ium tetrafluoroborate 950842-71-4 483.31
(5R,6R)-1-BENZYL-5-HYDROXY-6-(METHYLAMINO)-5,6-DIHYDRO-4H-IMIDAZO[4,5,1-IJ]CHINOLINE-2(1H)-ON 269731-84-2 C18H19N3O2 309.36236;g/mol 269731-84-2; SCHEMBL5906524; CTK4F8841; BKWXADRVJQEKGR-HZPDHXFCSA-N; ZINC36422389; (5R,6R)-1-BENZYL-5-HYDROXY-6-(METHYLAMINO)-5,6-DIHYDRO-4H-IMIDAZO[4,5,1-IJ]CHINOLINE-2(1H)-ON
(5R,15S)-Dihydroxy-(6E,8Z,11Z,13E)-eicosatetraenoic Acid 111990-31-9 C20H32O4 0 (5R,6E,8Z,11Z,13E,15S)-5,15-dihydroxyicosa-6,8,11,13-tetraenoicacid; 111990-31-9; ZINC26578301
(5r,11r)-5,11-diethyl-5,6,11,12-tetrahydro-2,8-chrysenediol 221368-54-3 C22H24O2 320.42
(5R)-Rosiglitazone hydrochloride 148622-14-4 C18H20ClN3O3S 393.886 (R)-Rosiglitazone hydrochloride; (+)-Rosiglitazone hydrochloride; (5R)-5-[[4-[2-[methyl(pyridin-2-yl)amino]ethoxy]phenyl]methyl]-1,3-thiazolidine-2,4-dione hydrochloride
(5R)-5-Hydroxy-L-lysine dihydrochloride monohydrate 172213-74-0 253.12 (2S,5R)-2,6-Diamino-5-hydroxycaproic acid dihydrochloride
(5R)-5-ETHYL-5-HYDROXY-1,4,5,8-TETRAHYDROOXEPINO[3,4-C]PYRIDINE-3,9-DIONE 221054-70-2 C11H13NO4 223.22522;g/mol (5R)-5-ethyl-5-hydroxy-4,8-dihydro-1H-oxepino[3,4-c]pyridine-3,9-dione; 221054-70-2; SCHEMBL5532480; CTK4E8603; RVBWWMADTISCJE-LLVKDONJSA-N; HE077130
(5R)-5-[[(1,1-Dimethylethyl)dimethylsily]oxy]-2-cyclohexen-1-one 225793-33-9 C12H22O2Si 226.38700
(5R)-5-(Chloromethyl)-3-(3-fluorophenyl)-2-oxazolidinone 879215-66-4 C10H9ClFNO2 229.64
(5R)-5-(3-Hydroxyphenyl)-3-methyl-1,3-oxazolidin-2-one 110193-49-2 C10H11NO3 193.20 (R)-3-[5-(N-Methyl-2-oxozolidonyl)]phenol
(5R)-5-(1,2-dihydroxyethyl)oxolane-2,3,4-trione 19455-06-2 C6H6O6 174.108 g/mol
(5R)-3-(3-Fluorophenyl)-5-[[(methylsulfonyl)oxy]methyl]-2-oxazolidinone 380380-55-2 C11H12FNO5S 289.28 (5R)-3-(3-FLUOROPHENYL)-5-[[(METHYLSULFONYL)OXY]METHYL]-2-OXAZOLIDINONE; 380380-55-2; SCHEMBL4163689; MSMCRHMUBYTUJP-SNVBAGLBSA-N; ZINC39351812; AKOS015917295
(5R)-3-(3-FLUORO-4-IODOPHENYL)-5-HYDROXYMETHYLOXAZOLIDIN-2-ONE 487041-08-7 C10H9FINO3 337.09 (5R)-3-(3-FLUORO-4-IODOPHENYL)-5-HYDROXYMETHYLOXAZOLIDIN-2-ONE
(5R)-2,2,3-TRIMETHYL-5-PHENYLMETHYL-4-IMIDAZOLIDINONE MONOHYDROCHLORIDE 323196-43-6 C13H19ClN2O 254.76 (5R)-(+)-2,2,3-TRIMETHYL-5-BENZYL-4-IMIDAZOLIDINONE MONOHYDROCHLORIDE; (5R)-2,2,3-TRIMETHYL-5-PHENYLMETHYL-4-IMIDAZOLIDINONE MONOHYDROCHLORIDE; MACMILLAN ORGANOCATALYST(TM) R218-HCL; MACMILLAN ORGANOCATALYST(TM) R255-HCL
(5R)-(+)-2,2,3-Trimethyl-5-benzyl-4-imidazolidinone dichloroacetic acid 857303-87-8 C15H20Cl2N2O3 347.24 ACETIC ACID, DICHLORO-, COMPD WITH (5R)-2,2,3-TRIMETHYL-5-PHENYLMETHYL-4-IMIDAZOLIDINONE (1:1); (5R)-(+)-2,2,3-TRIMETHYL-5-BENZYL-4-IMIDAZOLIDINONE DICHLOROACETIC ACID; (5R)-2,2,3-TRIMETHYL-5-PHENYLMETHYL-4-IMIDAZOLIDINONE DICHLOROACETIC ACID; MACMILLAN O
(5R)-(+)-2,2,3-Trimethyl-5-benzyl-4-imidazolidinone 685128-77-2 C13H18N2O
(5-P-TOLYL-TETRAZOL-2-YL)-ACETIC ACID 81595-00-8 C10H10N4O2 218.21 (5-P-TOLYL-TETRAZOL-2-YL)-ACETIC ACID; [5-(4-METHYLPHENYL)-2H-TETRAZOL-2-YL]ACETIC ACID
(5-p-Tolylamino-[1,3,4]thiadiazol-2-ylsulfanyl)-acetic acid hydrazide 52494-24-3 C11H13N5OS2 295.384
(5-Propyl-2-thienyl)-boronic acid 162607-24-1 C7H11BO2S 0 5-PROPYLTHIOPHENE-2-BORONIC ACID
(5-Phenyl-furan-2-yl)-methanol 22078-90-6 C11H10O2 174.2 (5-PHENYL-FURAN-2-YL)-METHANOL; (5-PHENYL-2-FURYL)METHANOL; AKOS BB-8303; ART-CHEM-BB B025316; ASISCHEM U67293; RARECHEM AL BD 0884
(5-PHENYL-4H-1,2,4-TRIAZOL-3-YL)ACETONITRILE 86999-29-3 C10H8N4 184.2 (5-PHENYL-4H-1,2,4-TRIAZOL-3-YL)ACETONITRILE
(5-PHENYL-4H-[1,2,4]TRIAZOL-3-YL)-ACETIC ACID 328084-14-6 C10H9N3O2 203.2 (5-PHENYL-4H-[1,2,4]TRIAZOL-3-YL)-ACETIC ACID; CHEMBRDG-BB 4401159; 2-(5-phenyl-4H-1,2,4-triazol-3-yl)aceticacid
(5-Phenyl-2H-tetrazol-2-yl)acetic acid 21743-68-0 C9H8N4O2 204.19 CHEMBRDG-BB 5926012; BUTTPARK 10\01-17; ART-CHEM-BB B018498; AKOS B018498; (5-PHENYL-TETRAZOL-2-YL)-ACETIC ACID; (5-PHENYL-2H-TETRAZOL-2-YL)ACETIC ACID
(5-Phenyl-[1,3,4]oxadiazol-2-ylsulfanyl)acetic acid 99361-50-9 C10H8N2O3S 236.25 ASISCHEM W87560; (5-PHENYL-[1,3,4]OXADIAZOL-2-YLSULFANYL)-ACETIC ACID; [(5-PHENYL-1,3,4-OXADIAZOL-2-YL)THIO]ACETIC ACID; AKOS TOT-0319; (5-Phenyl-[1,3,4]oxadiazol-2-ylsulfanyl)-acetic
(5-OXO-2-THIOPHEN-2-YL-CYCLOPENT-1-ENYL)-ACETIC ACID 436086-95-2 C11H10O3S 222.26 CHEMBRDG-BB 6844995; (5-OXO-2-THIOPHEN-2-YL-CYCLOPENT-1-ENYL)-ACETIC ACID
(5-OXO-2-P-TOLYL-CYCLOPENT-1-ENYL)-ACETIC ACID 78977-89-6 C14H14O3 230.26 (5-OXO-2-P-TOLYL-CYCLOPENT-1-ENYL)-ACETIC ACID
(5-Oxo-2-phenyl-cyclopent-1-enyl)acetic acid 42882-19-9 C13H12O3 216.23 (5-OXO-2-PHENYL-CYCLOPENT-1-ENYL)-ACETIC ACID; AKOS BB-9933; CHEMBRDG-BB 6832223
(5-oxo-1-pyridin-2-yl-2,5-dihydro-1H-pyrazol-3-yl)acetic acid 37959-19-6 C10H9N3O3 219.196
(5-Nitro-pyridin-2-yloxy)-acetic acid ethyl ester 392670-15-4 C9H10N2O5 0 (5-Nitro-pyridin-2-yloxy)-acetic acid ethyl ester
(5-METHYL-PYRIDIN-2-YLOXY)-ACETIC ACID ETHYL ESTER 864684-79-7 C10H13NO3 195.21512 (5-METHYL-PYRIDIN-2-YLOXY)-ACETIC ACID ETHYL ESTER
(5-Methyl-pyridin-2-yl)-piperidin-4-yl-amine 518285-55-7 C11H17N3 191.28 (5-METHYL-PYRIDIN-2-YL)-PIPERIDIN-4-YL-AMINE
(5-METHYL-PYRAZOL-1-YL)-ACETIC ACID 180741-44-0 C6H8N2O2 140.14 ART-CHEM-BB B007143; (5-METHYL-PYRAZOL-1-YL)-ACETIC ACID; AKOS B007143
(5-METHYL-INDOL-3-YL)METHYLAMINE 887596-96-5 C10H12N2 160.22 (5-METHYL-INDOL-3-YL)METHYLAMINE
(5-Methyl-benzo(b)thiophen-3-yl)acetic acid 1735-12-2 C11H10O2S 206.2609 (5-Methyl-benzo(b)thiophen-3-yl)acetic acid; 2-(5-methyl-1-benzothiophen-3-yl)acetic acid; 2-(5-methyl-1-benzothiophen-3-yl)ethanoic acid; 2-(5-methylbenzothiophen-3-yl)acetic acid
(5-METHYL-4,5-DIHYDRO-1H-PYRAZOL-1-YL)(PYRIDIN-3-YL)METHANONE 121306-58-9 C10H11N3O 189.21400
(5-METHYL-3-TRIFLUOROMETHYL-PYRAZOL-1-YL)-ACETIC ACID ETHYL ESTER 299405-24-6 C9H11F3N2O2 236.19 AKOS B016139; AKOS PAO-0935; (5-METHYL-3-TRIFLUOROMETHYL-PYRAZOL-1-YL)-ACETIC ACID ETHYL ESTER; ART-CHEM-BB B016139; TIMTEC-BB SBB009392
(5-Methyl-3-phenyl-4-isoxazolyl)methylamine 306935-01-3 C11H12N2O 188.23 4-(AMINOMETHYL)-5-METHYL-3-PHENYLISOXAZOLE; (5-METHYL-3-PHENYL-4-ISOXAZOLYL)METHYLAMINE; 1-(5-METHYL-3-PHENYLISOXAZOL-4-YL)METHYLAMINE
(5-METHOXY-1-METHYL-1H-INDOL-3-YL)ACETONITRILE 176688-98-5 C12H12N2O 200.23648 (5-METHOXY-1-METHYL-1H-INDOL-3-YL)ACETONITRILE
(5-Isopropyl-2-methylphenoxy)acetic acid 19728-20-2 C12H16O3 208.25
(5-Iodo-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl)acetic acid 57846-83-0 C6H5IN2O4 296.02 (5-IODO-2,4-DIOXO-3,4-DIHYDRO-2H-PYRIMIDIN-1-YL)-ACETIC ACID; CHEMBRDG-BB 5727846; (5-IODO-2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)ACETIC ACID
(5-hydroxy-2-phenyl-1-benzofuran-4-yl)methyl-dimethylazanium chloride 63112-42-5 C17H18ClNO2 303.783 g/mol
(5-Hydroxy-1H-indol-3-yl)acetic acid 1321-73-9 C10H9NO3 191.18 HYDROXYINDOLYL-3-ACETIC ACID, 5-; 5-HYDROXYINDOLE-3-ACETIC ACID; 5-HYDROXYINDOLYACETIC ACID; 5-HYDROXYINDOLYL-3-ACETIC ACID; 5-HIAA; 5-HYDROXY-3-INDOLEACETIC ACID; (5-HYDROXY-1H-INDOL-3-YL)-ACETIC ACID; TIMTEC-BB SBB003639
(5-Hydroxy-1-benzofuran-3-yl)(phenyl)methanone 17249-62-6 C15H10O3 238.24 (5-HYDROXY-1-BENZOFURAN-3-YL)(PHENYL)METHANONE
(5-FURAN-2-YL-4H-[1,2,4]TRIAZOL-3-YLSULFANYL)-ACETIC ACID 30452-55-2 C8H7N3O3S 225.22 CHEMBRDG-BB 6608594; (5-FURAN-2-YL-4H-[1,2,4]TRIAZOL-3-YLSULFANYL)-ACETIC ACID; ([5-(2-FURYL)-4H-1,2,4-TRIAZOL-3-YL]THIO)ACETIC ACID; 2-([5-(FURAN-2-YL)-4H-1,2,4-TRIAZOL-3-YL]SULFANYL)ACETIC ACID
(5-Fluoro-2-methyl-1H-indol-3-yl)acetic acid 71987-67-2 C11H10FNO2 207.20 TIMTEC-BB SBB011169; (5-FLUORO-2-METHYL-1H-INDOL-3-YL)-ACETIC ACID; CHEMBRDG-BB 4006288
(5-Fluoro-2-methyl-1H-inden-3-yl)acetic acid 32004-63-3 C12H11FO2 206.2150 (5-Fluoro-2-methyl-1H-inden-3-yl)acetic acid
(5-FLUORO-1H-INDOL-3-YL)METHANAMINE 113188-82-2 C9H9FN2 164.18 5-FLUORO-1H-INDOL-3-METHYLAMINE; (5-FLUORO-1H-INDOL-3-YL)METHANAMINE
(5-FLUORO-1H-INDOL-2-YL)METHANAMINE 883531-07-5 C9H9FN2 164.18 (5-FLUORO-1H-INDOL-2-YL)METHANAMINE; [(5-FLUORO-1H-INDOL-2-YL)METHYL]AMINE; (5-Fluoro-1H-indol-2-yl)metanamine
(5-FLUORO-1H-INDAZOL-3-YL)-METHANOL 518990-02-8 C8H7FN2O 166.15 (5-FLUORO-1H-INDAZOL-3-YL)-METHANOL
(5-FLUORO-1H-INDAZOL-3-YL)-ACETIC ACID 885271-22-7 C9H7FN2O2 194.16 (5-FLUORO-1H-INDAZOL-3-YL)-ACETIC ACID
(5-ETHYL-2-HYDROXYPHENYL)(1-PHENYL-1H-PYRAZOL-4-YL)METHANONE 288401-56-9 C18H16N2O2 292.33 4-(5-ETHYL-2-HYDROXYBENZOYL)-1-PHENYLPYRAZOLE; (5-ETHYL-2-HYDROXYPHENYL)(1-PHENYL-1H-PYRAZOL-4-YL)METHANONE
(5-ETHYL-[1,3,4]OXADIAZOL-2-YLSULFANYL)-ACETIC ACID 597545-23-8 C6H8N2O3S 188.2 CHEMBRDG-BB 4012338; (5-ETHYL-[1,3,4]OXADIAZOL-2-YLSULFANYL)-ACETIC ACID; AKOS TOT-0249; [(5-ETHYL-1,3,4-OXADIAZOL-2-YL)THIO]ACETIC ACID; UKRORGSYN-BB BBV-201620
(5E)-5-[4-(Difluoromethoxy)benzylidene]-2-mercapto-1,3-thiazol-4(5H)-one 337933-33-2 C11H7F2NO2S2 287.31 AKOS B018225; CHEMBRDG-BB 3018225; ART-CHEM-BB B018225; (5E)-5-[4-(difluoromethoxy)benzylidene]-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009175
(5E)-5-[4-(Allyloxy)benzylidene]-2-mercapto-1,3-thiazol-4(5H)-one 361184-37-4 C13H11NO2S2 277.36 AKOS B018249; CHEMBRDG-BB 3018249; ART-CHEM-BB B018249; (5E)-5-[4-(allyloxy)benzylidene]-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009163
(5E)-5-[(6-Chloro-1,3-benzodioxol-5-yl)methylene]-2-mercapto-1,3-thiazol-4(5H)-one 292172-54-4 C11H6ClNO3S2 299.75 CHEMBRDG-BB 3018369; ART-CHEM-BB B018369; (5E)-5-[(6-chloro-1,3-benzodioxol-5-yl)methylene]-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009177
(5E)-5-[(2-Hydroxy-1-naphthyl)methylene]-2-mercapto-1,3-thiazol-4(5H)-one 268736-98-7 C14H9NO2S2 287.36 ART-CHEM-BB B018341; CHEMBRDG-BB 3018341; (5E)-5-[(2-hydroxy-1-naphthyl)methylene]-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009143
(5E)-5-(Biphenyl-4-ylmethylene)-2-mercapto-1,3-thiazol-4(5H)-one 110932-40-6 C16H11NOS2 297.39 ART-CHEM-BB B018354; CHEMBRDG-BB 3018354; (5E)-5-(biphenyl-4-ylmethylene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009161
(5E)-5-(5-Chloro-2-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 352700-55-1 C11H8ClNO2S2 285.77 ART-CHEM-BB B018254; CHEMBRDG-BB 3018254; AKOS B018254; (5E)-5-(5-chloro-2-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009165
(5E)-5-(5-Chloro-2-hydroxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 6320-49-6 C10H6ClNO2S2 271.74 CHEMBRDG-BB 3018367; ART-CHEM-BB B018367; AKOS B018367; (5E)-5-(5-chloro-2-hydroxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Nsc31201
(5E)-5-(5-Chloro-2-ethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 299903-84-7 C12H10ClNO2S2 299.8 CHEMBRDG-BB 3018255; ART-CHEM-BB B018255; AKOS B018255; (5E)-5-(5-chloro-2-ethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009164
(5E)-5-(4-tert-Butylbenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 312607-49-1 C14H15NOS2 277.4 AKOS B018345; ART-CHEM-BB B018345; CHEMBRDG-BB 3018345; (5E)-5-(4-tert-butylbenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009121
(5E)-5-(4-Isopropylbenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 100393-19-9 C13H13NOS2 263.38 AKOS B018344; CHEMBRDG-BB 3018344; ART-CHEM-BB B018344; (5E)-5-(4-isopropylbenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009119
(5E)-5-(4-Isopropoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 303798-03-0 C13H13NO2S2 279.38 ART-CHEM-BB B018241; CHEMBRDG-BB 3018241; AKOS B018241; (5E)-5-(4-isopropoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009155
(5E)-5-(4-Isobutoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 164520-75-6 C14H15NO2S2 293.4 AKOS B018243; CHEMBRDG-BB 3018243; ART-CHEM-BB B018243; (5E)-5-(4-isobutoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009154
(5E)-5-(4-Hydroxy-3-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 5447-37-0 C11H9NO3S2 267.32 AKOS B018319; ART-CHEM-BB B018319; CHEMBRDG-BB 3018319; (5E)-5-(4-hydroxy-3-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; 2-Thioxo-5-(3-methoxy-4-hydroxybenzylidene)thiazolidine-4-one; 5-(4-Hydroxy-3-methoxybenzylidene)-2-thioxothiazolidin-4-one
(5E)-5-(4-Fluorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 402-93-7 C10H6FNOS2 239.29 ART-CHEM-BB B018301; CHEMBRDG-BB 3018301; AKOS B018301; (5E)-5-(4-fluorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; 5-(4-Fluorobenzylidene)rhodanine; Brn 0171047
(5E)-5-(4-Ethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 100063-24-9 C12H11NO2S2 265.35 CHEMBRDG-BB 3018329; ART-CHEM-BB B018329; AKOS B018329; (5E)-5-(4-ethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009152
(5E)-5-(4-Chlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 81154-18-9 C10H6ClNOS2 255.74 CHEMBRDG-BB 3018300; ART-CHEM-BB B018300; AKOS B018300; (5E)-5-(4-chlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009146
(5E)-5-(3-Isopropoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 127378-77-2 C13H13NO2S2 279.38 ART-CHEM-BB B018235; CHEMBRDG-BB 3018235; AKOS B018235; (5E)-5-(3-isopropoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009178
(5E)-5-(3-Hydroxy-4-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 69505-47-1 C11H9NO3S2 267.32 CHEMBRDG-BB 3018320; ART-CHEM-BB B018320; AKOS B018320; (5E)-5-(3-hydroxy-4-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009171
(5E)-5-(3-Fluorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 349-33-7 C10H6FNOS2 239.29 CHEMBRDG-BB 3018302; ART-CHEM-BB B018302; AKOS B018302; (5E)-5-(3-fluorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009150
(5E)-5-(3-ETHYL-4-OXO-2-THIOXO-1,3-THIAZOLIDIN-5-YLIDENE)-3-[(Z)-(3-ETHYL-1,3-BENZOTHIAZOL-2(3H)-YLIDENE)METHYL]CYCLOHEX-3-ENE-1-CARBOXAMIDE 54118-08-0 C22H23N3O2S3 457.63 (5E)-5-(3-ETHYL-4-OXO-2-THIOXO-1,3-THIAZOLIDIN-5-YLIDENE)-3-[(Z)-(3-ETHYL-1,3-BENZOTHIAZOL-2(3H)-YLIDENE)METHYL]CYCLOHEX-3-ENE-1-CARBOXAMIDE; 3-CYCLOHEXENE-1-CARBOXAMIDE, 3-[(3-ETHYL-2(3H)-BENZOTHIAZOLYLIDENE)METHYL]-5-(3-ETHYL-4-OXO-2-THIOXO-5-THIAZOLIDI
(5E)-5-(3-Ethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 127378-24-9 C12H11NO2S2 265.35 AKOS B018233; CHEMBRDG-BB 3018233; ART-CHEM-BB B018233; (5E)-5-(3-ethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009159
(5E)-5-(3-Chlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 23622-20-0 C10H6ClNOS2 255.74 CHEMBRDG-BB 3018298; ART-CHEM-BB B018298; AKOS B018298; (5E)-5-(3-chlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009166
(5E)-5-(3,4-Dichlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 6326-22-3 C10H5Cl2NOS2 290.19 ART-CHEM-BB B018299; CHEMBRDG-BB 3018299; AKOS B018299; (5E)-5-(3,4-dichlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Nsc31200
(5E)-5-(2-Isopropoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 352540-00-2 C13H13NO2S2 279.38 CHEMBRDG-BB 3018246; ART-CHEM-BB B018246; AKOS B018246; (5E)-5-(2-isopropoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009170
(5E)-5-(2-Isobutoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 669747-27-7 C14H15NO2S2 293.4 AKOS B018251; CHEMBRDG-BB 3018251; ART-CHEM-BB B018251; (5E)-5-(2-isobutoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009181
(5E)-5-(2-Hydroxy-3-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 99972-65-3 C11H9NO3S2 267.32 AKOS B018316; CHEMBRDG-BB 3018316; ART-CHEM-BB B018316; (5E)-5-(2-hydroxy-3-methoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009168
(5E)-5-(2-Fluorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 350-22-1 C10H6FNOS2 239.29 AKOS B018293; ART-CHEM-BB B018293; CHEMBRDG-BB 3018293; (5E)-5-(2-fluorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009167
(5E)-5-(2-Chlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 81154-00-9 C10H6ClNOS2 255.74 AKOS B018295; ART-CHEM-BB B018295; CHEMBRDG-BB 3018295; (5E)-5-(2-chlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009147
(5E)-5-(2,6-Dichlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 65562-49-4 C10H5Cl2NOS2 290.19 AKOS B018296; CHEMBRDG-BB 3018296; ART-CHEM-BB B018296; (5E)-5-(2,6-dichlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one
(5E)-5-(2,5-Dimethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 127378-17-0 C12H11NO3S2 281.35 AKOS B018332; CHEMBRDG-BB 3018332; ART-CHEM-BB B018332; (5E)-5-(2,5-dimethoxybenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009136
(5E)-5-(2,3-Dichlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one 90407-17-3 C10H5Cl2NOS2 290.19 CHEMBRDG-BB 3018297; ART-CHEM-BB B018297; AKOS B018297; (5E)-5-(2,3-dichlorobenzylidene)-2-mercapto-1,3-thiazol-4(5H)-one; Albb-009162
(5E)-2-Mercapto-5-(3-methylbenzylidene)-1,3-thiazol-4(5H)-one 127378-26-1 C11H9NOS2 235.33 CHEMBRDG-BB 3018338; ART-CHEM-BB B018338; AKOS B018338; (5E)-2-mercapto-5-(3-methylbenzylidene)-1,3-thiazol-4(5H)-one; Albb-009120
(5E)-2-Mercapto-5-(2-nitrobenzylidene)-1,3-thiazol-4(5H)-one 6308-22-1 C10H6N2O3S2 266.3 AKOS B018304; ART-CHEM-BB B018304; CHEMBRDG-BB 3018304; (5E)-2-mercapto-5-(2-nitrobenzylidene)-1,3-thiazol-4(5H)-one
(5E)-2-Mercapto-5-(2-naphthylmethylene)-1,3-thiazol-4(5H)-one 107916-92-7 C14H9NOS2 271.36 ART-CHEM-BB B018336; CHEMBRDG-BB 3018336; AKOS B018336; (5E)-2-mercapto-5-(2-naphthylmethylene)-1,3-thiazol-4(5H)-one; Albb-009141
(5E)-2-Mercapto-5-(2-methylbenzylidene)-1,3-thiazol-4(5H)-one 50459-52-4 C11H9NOS2 235.33 ART-CHEM-BB B018337; CHEMBRDG-BB 3018337; AKOS B018337; (5E)-2-mercapto-5-(2-methylbenzylidene)-1,3-thiazol-4(5H)-one; Albb-009173
(5E)-2-Mercapto-5-(2-methoxybenzylidene)-1,3-thiazol-4(5H)-one 81154-09-8 C11H9NO2S2 251.32 AKOS B018324; ART-CHEM-BB B018324; CHEMBRDG-BB 3018324; (5E)-2-mercapto-5-(2-methoxybenzylidene)-1,3-thiazol-4(5H)-one; Albb-009153
(5E)-2-Mercapto-5-(1-naphthylmethylene)-1,3-thiazol-4(5H)-one 65562-51-8 C14H9NOS2 271.36 AKOS B018335; CHEMBRDG-BB 3018335; ART-CHEM-BB B018335; (5E)-2-mercapto-5-(1-naphthylmethylene)-1,3-thiazol-4(5H)-one
(5-Cyanopyridin-3-yl)methanol 135124-71-9
(5-chlorothiophen-2-yl)methanamine hydrochloride 548772-41-4 C5H7Cl2NS 184.08678;g/mol (5-chlorothiophen-2-yl)methanamine;hydrochloride;(5-chlorothiophen-2-yl)methanaminehydrochloride;548772-41-4;(5-chlorothien-2-yl)methylaminehydrochloride;C5H7Cl2NS
(5-CHLORO-THIOPHEN-2-YL)-CARBAMIC ACID TERT-BUTYL ESTER 63806-71-3 C9H12ClNO2S 233.71508 (5-CHLORO-THIOPHEN-2-YL)-CARBAMIC ACID TERT-BUTYL ESTER
(5-CHLOROBENZO[D]THIAZOL-2-YL)GUANIDINE 885044-06-4
(5-Chloro-3-methyl-1-phenyl-1H-pyrazol-4-yl)methanol 1136-60-3 C11H11ClN2O 0 (5-chloro-3-methyl-1-phenyl-pyrazol-4-yl)methanol
(5-CHLORO-2-METHOXY-PHENYL)-HYDRAZINE HYDROCHLORIDE 5446-16-2 C7H10Cl2N2O 209.07 1-(5-CHLORO-2-METHOXYPHENYL)HYDRAZINE HYDROCHLORIDE; (5-CHLORO-2-METHOXY-PHENYL)-HYDRAZINE HYDROCHLORIDE; BIO-FARMA BF001051
(5-Chloro-2-methoxyphenyl)acetic acid methyl ester 26939-01-5 C10H11ClO3 214.65 (5-chloro-2-methoxyphenyl)acetic acid methyl ester
(5-Chloro-2-methoxyphenyl)-4-pyridinyl-methanone 329947-10-6 C13H10ClNO2 247.677;g/mol (5-chloro-2-methoxyphenyl)-pyridin-4-ylmethanone;329947-10-6;(5-CHLORO-2-METHOXYPHENYL)-4-PYRIDINYL-METHANONE;(5-CHLORO-2-METHOXYPHENYL)-PYRIDIN-4-YL-METHANONE;SCHEMBL14419510;CTK4G9692
(5-CHLORO-2-METHOXYBENZYL)HYDRAZINE 90002-87-2
(5-chloro-2-methoxybenzyl)ethylamine x1HCl 892587-96-1
(5-Chloro-2-iodophenyl)(2,6-difluorophenyl)methanone 869365-97-9 C13H6ClF2IO 0 (5-CHLORO-2-IODOPHENYL) 2,6-DIFLUOROPHENYL METHANO
(5-CHLORO-2-HYDROXYPHENYL)(1-PHENYL-1H-PYRAZOL-4-YL)METHANONE 61466-46-4 C16H11ClN2O2 298.72 1-PHENYL-4(5-CHLORO-2-HYDROXYBENZOYL)-PYRAZOLE; (5-CHLORO-2-HYDROXYPHENYL)(1-PHENYL-1H-PYRAZOL-4-YL)METHANONE; 4-(5-CHLORO-2-HYDROXYBENZOYL)-1-PHENYLPYRAZOLE; TIMTEC-BB SBB001226
(5-Chloro-2-ethyl-1H-imidazol-4-yl)-methanol 146650-65-9 C6H9ClN2O 160.6 (5-CHLORO-2-ETHYL-1H-IMIDAZOL-4-YL)-METHANOL
(5-Chloro-2-(methylamino)phenyl)methanol 951883-91-3 C8H10ClNO 0 (5-Chloro-2-(methylamino)phenyl)methanol; N-Methyl 4-chloro-2-hydroxymethylaniline
(5-CHLORO-2-(1H-1,2,4-TRIAZOL-1-YL)PHENYL)METHANAMINE 404922-72-1 C9H9ClN4 208.65 (5-CHLORO-2-(1H-1,2,4-TRIAZOL-1-YL)PHENYL)METHANAMINE
(5-Chloro-1-methyl-3-phenyl-1H-pyrazol-4-yl)methanol 321538-17-4 C11H11ClN2O 222.67 (5-CHLORO-1-METHYL-3-PHENYL-1H-PYRAZOL-4-YL)METHANOL; 5-CHLORO-1-METHYL-3-PHENYL-1H-PYRAZOLE-4-METHANOL; UKRORGSYN-BB BBV-5108877
(5-Chloro-1H-indazol-3-yl)methanol 102735-90-0 C8H7ClN2O 0 (5-Chloro-1H-indazol-3-yl)-methanol ,97%
(5-Chloro-1-benzothiophen-3-yl)methylamine 71625-90-6 C9H8 Cl N S 197.68 BUTTPARK 96\50-45; 5-CHLOROBENZOTHIOPHENE-3-METHYLAMINE; (5-CHLORO-1-BENZOTHIOPHENE-3-YL)METHYLAMINE; (5-CHLORO-1-BENZOTHIOPHEN-3-YL)METHYLAMINE; (5-CHLORO-1-BENZOTHIOPHEN-3-YL)METHYLAMINE HYDROCHLORIDE; RARECHEM AL BW 1019; 5-Chlorobenzo[b]thiophen-3-ylm
(5-Chloro-1-benzothiophen-3-yl)methanol 306934-93-0 C9H7ClOS 198.67 RARECHEM AL BD 1312; (5-CHLORO-1-BENZOTHIOPHEN-3-YL)METHANOL; (5-CHLORO-1-BENZOTHIOPHENE-3-YL)METHANOL; 5-CHLORO-3-(HYDROXYMETHYL)BENZOTHIOPHENE; (5-Chloro-1-benzothiophen-3-yl)methanol ,97%
(5-CHLORO-1,3-DIMETHYL-1H-PYRAZOL-4-YL)(1,3-DIMETHYL-1H-PYRAZOL-5-YL)METHANONE 648859-52-3 C11H13ClN4O 252.7 (5-CHLORO-1,3-DIMETHYL-1H-PYRAZOL-4-YL)(1,3-DIMETHYL-1H-PYRAZOL-5-YL)METHANONE
(5-carbamoyl-1H-imidazol-4-yl) 3,5,7-trimethyladamantane-1-carboxylate 79013-42-6 C18H25N3O3 331.409 g/mol
(5-BROMO-THIOPHEN-2-YL)-ACETONITRILE 71637-37-1 C6H4BrNS 202.07 (5-BROMO-THIOPHEN-2-YL)-ACETONITRILE
(5-Bromothien-2-yl)methanol 79387-71-6 C5H5BrOS 193.06 (5-Bromo-2-thienyl)methanol; (5-Bromothien-2-yl)methanol
(5-BROMO-PYRIMIDIN-2-YL)-DIETHYL-AMINE 433684-23-2 C8H12BrN3 230.1 (5-BROMO-PYRIMIDIN-2-YL)-DIETHYL-AMINE; 5-BROMO-N,N-DIETHYLPYRIMIDIN-2-AMINE
(5-BROMO-4-METHYL-3-NITRO-PYRIDIN-2-YL)-METHYL-AMINE 155790-01-5 C7H8BrN3O2 246.06132 (5-BROMO-4-METHYL-3-NITRO-PYRIDIN-2-YL)-METHYL-AMINE; 5-Bromo-2-methylamino-3-nitro-4-picoline; 5-Bromo-4-methyl-2-methylamino-3-nitropyridine; 5-Bromo-N,4-dimethyl-3-nitropyridin-2-amine
(5-BROMO-3-NITRO-PYRIDIN-2-YL)-ISOPROPYL-AMINE 954228-62-7 C8H10BrN3O2 260.0879 (5-BROMO-3-NITRO-PYRIDIN-2-YL)-ISOPROPYL-AMINE
(5-BROMO-2-FLUORO-PHENYL)-HYDRAZINE 627871-08-3 C6H6BrFN2 205.03 (5-BROMO-2-FLUORO-PHENYL)-HYDRAZINE
(5-Bromo-1H-indazol-3-yl)methanamine 885271-37-4 C8H8BrN3 226.07 C-(5-BROMO-1H-INDAZOL-3-YL)-METHYLAMINE
(5-Bromo-1H-indazol-3-yl)acetic acid 885271-84-1 C9H7BrN2O2 255.07 (5-BROMO-1H-INDAZOL-3-YL)-ACETIC ACID
(5-BENZYLOXY-1H-INDOL-3-YL)-ACETIC ACID HYDRAZIDE 112273-39-9 C17H17N3O2 295.34 (5-BENZYLOXY-1H-INDOL-3-YL)-ACETIC ACID HYDRAZIDE; 5-BENZYLOXYINDOLE-3-ACETIC ACID HYDRAZIDE
(5-benzyl-2-furyl)methyl (1S,3S)-2,2-dimethyl-3-(2-methylprop-1-enyl)c yclopropane-1-carboxylate 35764-59-1 C22H26O3 0 (5-benzyl-2-furyl)methyl (1S,3S)-2,2-dimethyl-3-(2-methylprop-1-enyl)c yclopropane-1-carboxylate; cismethrin; CIS-RESMETHRIN; (1R,3S)-2,2-Dimethyl-3-(2-methyl-1-propenyl)cyclopropanecarboxylic acid (5-benzyl-3-furanyl)methyl ester; (1R,3S)-2,2-Dimethyl-3-
(5AR,10BS)-(+)-5A,10B-DIHYDRO-2-(PENTAFLUOROPHENYL)-4H,6H-INDENO[2,1-B][1,2,4]TRIZOLO[4,3-D][1,4]OXAZINIUM TETRAFLUOROBORATE 872143-57-2 C18H11BF9N3O 467.1 2-PENTAFLUOROPHENYL-6,10B-DIHYDRO-4H,5AH-5-OXO-3,10C-DIAZA-2-AZONIACYCLOPENTA[C]FLUORINE TETRAFLUOROBORATE; 5A(R),10B(S)-5A,10B-DIHYDRO-2-(PENTAFLUOROPHENYL)-4H,6H-INDENO[2,1-B][1,2,4]TRIAZOLO[4,3-D][1,4]OXAZINIUM TETRAFLUOROBORATE; (5AR,10BS)-(+)-5A,10B-
(5-Aminopentyl)(phenylmethoxy)carbamic acid tert-butyl ester 129245-21-2 C17H28N2O3 308.42 tert-butylN-(5-aminopentyl)-N-phenylmethoxycarbamate; (5-Aminopentyl)(phenylmethoxy)carbamicacidtert-butylester; 129245-21-2; MLS002666817; SCHEMBL8863680; CHEMBL1894105
(5-AMINO-2-METHYL-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER 329763-32-8 C12H18N2O2 222.28 (5-AMINO-2-METHYL-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER; Carbamic acid, (5-amino-2-methylphenyl)-, 1,1-dimethylethyl ester (9CI)
(5-AMINO-2-METHOXY-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER 312300-45-1 C12H18N2O3 238.28 (5-AMINO-2-METHOXY-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER
(5-AMINO-2-FLUORO-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER 535170-18-4 C11H15FN2O2 226.25 (5-AMINO-2-FLUORO-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER
(5-AMINO-2-CHLORO-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER 879614-93-4 C11H15ClN2O2 242.7 (5-AMINO-2-CHLORO-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER
(5-Amino-2-chloro-4-pyridinyl)-carbamic acid 1,1-dimethylethyl ester 240815-75-2 C10H14ClN3O2 243.69006;g/mol tert-butylN-(5-amino-2-chloropyridin-4-yl)carbamate;240815-75-2;tert-Butyl(5-amino-2-chloropyridin-4-yl)carbamate;tert-butyl5-amino-2-chloro(pyridin-4-yl)carbamate;SCHEMBL4036319;CTK4F2887
(5-Amino-2-butyl-3-benzofuranyl)[4-[3-(dibutylamino)propoxy]phenyl]-methanone ethanedioate 500791-70-8 C30H42N2O3.2(C2H2O4) 658.75 (5-Amino-2-butyl-3-benzofuranyl)[4-[3-(dibutylamino)propoxy]phenyl]-methanone ethanedioate
(5-amino-2-butyl-3-benzofuranyl)[4-[3-(dibutylamino)propoxy]phenyl]-,oxalate 851014-95-4 C32H44N2O7 568.3 (5-amino-2-butyl-3-benzofuranyl)[4-[3-(dibutylamino)propoxy]phenyl]-,oxalate
(5-AMINO-2-BROMO-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER 885270-68-8 C11H15BrN2O2 287.15 (5-AMINO-2-BROMO-PHENYL)-CARBAMIC ACID TERT-BUTYL ESTER
(5-AMINO-1-P-TOLYL-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-15-9 C18H17N3O 291.35 (5-AMINO-1-P-TOLYL-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; SALOR-INT L251739-1EA; (5-AMINO-1-(4-METHYLPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-P-TOLYL-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-13-7 C17H14ClN3O 311.77 SALOR-INT L251720-1EA; (5-AMINO-1-P-TOLYL-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; (5-AMINO-1-(4-METHYLPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(THIOPHEN-2-YL)METHANONE 618091-64-8 C14H11N3OS 269.32 (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(THIOPHEN-2-YL)METHANONE; SALOR-INT L252093-1EA; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(2-THIENYL)METHANONE
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-04-6 C17H15N3O 277.32 (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; SALOR-INT L251690-1EA; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(M-TOLYL)METHANONE 618091-07-9 C17H15N3O 277.32 SALOR-INT L251704-1EA; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(M-TOLYL)METHANONE; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(3-METHYLPHENYL)METHANONE
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(FURAN-2-YL)METHANONE 54606-39-2 C14H11N3O2 253.26 SALOR-INT L252107-1EA; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(FURAN-2-YL)METHANONE; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(2-FURYL)METHANONE
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(4-METHOXYPHENYL)METHANONE 54606-40-5 C17H15N3O2 293.32 (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(4-METHOXYPHENYL)METHANONE; SALOR-INT L251666-1EA
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE 54606-38-1 C16H12ClN3O 297.74 (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE; SALOR-INT L251674-1EA
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-10-4 C16H12BrN3O 342.19 SALOR-INT L251712-1EA; (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE
(5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 190269-18-2 C16H12ClN3O 297.74 (5-AMINO-1-PHENYL-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L251682-1EA
(5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-75-1 C18H17N3O 291.35 SALOR-INT L252158-1EA; (5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(2-METHYLPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE 618091-80-8 C17H14ClN3O 311.77 SALOR-INT L252174-1EA; (5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE; (5-AMINO-1-(2-METHYLPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE
(5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-78-4 C17H14BrN3O 356.22 (5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE; SALOR-INT L252166-1EA; (5-AMINO-1-(2-METHYLPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE
(5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-72-8 C17H14ClN3O 311.77 (5-AMINO-1-O-TOLYL-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L252131-1EA; (5-AMINO-1-(2-METHYLPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE
(5-amino-1H-tetrazol-1-yl)acetic acid 21743-62-4 143.11
(5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-21-7 C18H17N3O2 307.35 SALOR-INT L251763-1EA; (5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE 618091-17-1 C17H14ClN3O2 327.76 (5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE; SALOR-INT L251747-1EA
(5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-19-3 C17H14ClN3O2 327.76 (5-AMINO-1-(4-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L251755-1EA
(5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-44-4 C17H14FN3O 295.31 SALOR-INT L251895-1EA; (5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE 618091-38-6 C16H11ClFN3O 315.73 SALOR-INT L251860-1EA; (5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE
(5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-40-0 C16H11BrFN3O 360.18 (5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE; SALOR-INT L251879-1EA
(5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-42-2 C16H11ClFN3O 315.73 (5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L251887-1EA
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(P-TOLYL)METHANONE 618091-23-9 C17H14ClN3O 311.77 (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(P-TOLYL)METHANONE; SALOR-INT L251771-1EA; (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-34-2 C17H14ClN3O 311.77 SALOR-INT L251844-1EA; (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(M-TOLYL)METHANONE 618091-36-4 C17H14ClN3O 311.77 (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(M-TOLYL)METHANONE; SALOR-INT L251852-1EA; (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(3-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-METHOXYPHENYL)METHANONE 618091-25-1 C17H14ClN3O2 327.76 SALOR-INT L251798-1EA; (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-METHOXYPHENYL)METHANONE
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE 618091-27-3 C16H11Cl2N3O 332.18 (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE; SALOR-INT L251801-1EA
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-29-5 C16H11BrClN3O 376.64 (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE; SALOR-INT L251828-1EA
(5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-32-0 C16H11Cl2N3O 332.18 (5-AMINO-1-(4-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L251836-1EA
(5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(THIOPHEN-2-YL)METHANONE 618091-98-8 C14H10BrN3OS 348.22 SALOR-INT L252263-1EA; (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(THIOPHEN-2-YL)METHANONE; (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(2-THIENYL)METHANONE
(5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(P-TOLYL)METHANONE 618091-90-0 C17H14BrN3O 356.22 SALOR-INT L252220-1EA; (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(P-TOLYL)METHANONE; (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(4-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-92-2 C17H14BrN3O 356.22 SALOR-INT L252239-1EA; (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-94-4 C16H11BrClN3O 376.64 (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L252247-1EA
(5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(2-BROMOPHENYL)METHANONE 618091-96-6 C16H11Br2N3O 421.09 (5-AMINO-1-(4-BROMOPHENYL)-1H-PYRAZOL-4-YL)(2-BROMOPHENYL)METHANONE; SALOR-INT L252255-1EA
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(P-TOLYL)METHANONE 618091-46-6 C17H14ClN3O 311.77 SALOR-INT L251909-1EA; (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(P-TOLYL)METHANONE; (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-METHYLPHENYL)METHANONE
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-56-8 C17H14ClN3O 311.77 (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; SALOR-INT L251968-1EA; (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(M-TOLYL)METHANONE 618091-58-0 C17H14ClN3O 311.77 (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(M-TOLYL)METHANONE; SALOR-INT L251976-1EA; (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(3-METHYLPHENYL)METHANONE
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(FURAN-2-YL)METHANONE 618091-66-0 C14H10ClN3O2 287.7 (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(FURAN-2-YL)METHANONE; SALOR-INT L252115-1EA; (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-FURYL)METHANONE
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-METHOXYPHENYL)METHANONE 618091-48-8 C17H14ClN3O2 327.76 (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-METHOXYPHENYL)METHANONE; SALOR-INT L251917-1EA
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE 618091-50-2 C16H11Cl2N3O 332.18 (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-CHLOROPHENYL)METHANONE; SALOR-INT L251925-1EA
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-52-4 C16H11BrClN3O 376.64 SALOR-INT L251933-1EA; (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE
(5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-54-6 C16H11Cl2N3O 332.18 (5-AMINO-1-(3-CHLOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L251941-1EA
(5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618092-06-1 C17H13ClFN3O 329.76 SALOR-INT L252328-1EA; (5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618092-10-7 C16H10BrClFN3O 394.63 (5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE; SALOR-INT L252344-1EA
(5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618092-08-3 C16H10Cl2FN3O 350.17 (5-AMINO-1-(3-CHLORO-4-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L252336-1EA
(5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618092-00-5 C18H17N3O2 307.35 (5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; SALOR-INT L252271-1EA; (5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618092-04-9 C17H14BrN3O2 372.22 SALOR-INT L252301-1EA; (5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE
(5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618092-02-7 C17H14ClN3O2 327.76 (5-AMINO-1-(2-METHOXYPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE; SALOR-INT L252298-1EA
(5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE 618091-86-4 C17H14FN3O 295.31 SALOR-INT L252204-1EA; (5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(O-TOLYL)METHANONE; (5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-METHYLPHENYL)METHANONE
(5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(FURAN-2-YL)METHANONE 618091-88-6 C14H10FN3O2 271.25 SALOR-INT L252212-1EA; (5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(FURAN-2-YL)METHANONE; (5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-FURYL)METHANONE
(5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-84-2 C16H11BrFN3O 360.18 SALOR-INT L252190-1EA; (5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE
(5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE 618091-82-0 C16H11ClFN3O 315.73 SALOR-INT L252182-1EA; (5-AMINO-1-(2-FLUOROPHENYL)-1H-PYRAZOL-4-YL)(2-CHLOROPHENYL)METHANONE
(5-AMINO-1-(2,4-DIFLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE 618091-69-3 C16H10BrF2N3O 378.17 (5-AMINO-1-(2,4-DIFLUOROPHENYL)-1H-PYRAZOL-4-YL)(4-BROMOPHENYL)METHANONE; SALOR-INT L252123-1EA
(5-AMINO-[1,3,4]THIADIAZOL-2-YLSULFANYL)-ACETIC ACID 32418-26-1 C4H5N3O2S2 191.231 2-[(5-amino-1,3,4-thiadiazol-2-yl)sulfanyl]aceticacid; 32418-26-1; (5-Amino-[1,3,4]thiadiazol-2-ylsulfanyl)-aceticacid; 2-[(5-amino-1,3,4-thiadiazol-2-yl)sulfanyl]aceticAcid; 2-((5-amino-1,3,4-thiadiazol-2-yl)thio)aceticacid; F2124-0410
(5-AMINO-[1,3,4]THIADIAZOL-2-YL)-ACETIC ACID 118863-94-8 C4H5N3O2S 159.17 CHEMBRDG-BB 4012640; (5-AMINO-[1,3,4]THIADIAZOL-2-YL)-ACETIC ACID; TIMTEC-BB SBB010409
(5-acetyloxy-4,4-diphenylheptan-2-yl)-dimethylazanium chloride 38821-43-1 C23H32ClNO2 389.959 g/mol
(5,9-DIHYDRO-6,8-DIOXA-BENZOCYCLOHEPTEN-7-YL-METHYL)-P-TOLYL-AMINE 309720-04-5 C17H19NO2 269.34 (5,9-DIHYDRO-6,8-DIOXA-BENZOCYCLOHEPTEN-7-YL-METHYL)-P-TOLYL-AMINE
(5,9-DIHYDRO-6,8-DIOXA-BENZOCYCLOHEPTEN-7-YLMETHYL)-ISOBUTYL-AMINE 435345-27-0 C14H21NO2 235.32 (5,9-DIHYDRO-6,8-DIOXA-BENZOCYCLOHEPTEN-7-YLMETHYL)-ISOBUTYL-AMINE
(5,9-DIHYDRO-6,8-DIOXA-BENZOCYCLOHEPTEN-7-YL-METHYL)-(4-METHOXY-PHENYL)-AMINE 312585-47-0 C17H19NO3 285.34 (5,9-DIHYDRO-6,8-DIOXA-BENZOCYCLOHEPTEN-7-YL-METHYL)-(4-METHOXY-PHENYL)-AMINE
(5,7-DIMETHYL-[1,2,4]TRIAZOLO[4,3-A]PYRIMIDIN-3-YLSULFANYL)-ACETIC ACID 41266-71-1 C9H10N4O2S 238.27 OTAVA-BB BB7211810319; AKOS BC-3014; (5,7-DIMETHYL-[1,2,4]TRIAZOLO[4,3-A]PYRIMIDIN-3-YLSULFANYL)-ACETIC ACID; AURORA 23328; IFLAB-BB F0896-0388
(5,6-DIMETHYL-THIENO[2,3-D]PYRIMIDIN-4-YLSULFANYL)-ACETIC ACID 296262-16-3 C10H10N2O2S2 254.33 AURORA 20736; (5,6-DIMETHYL-THIENO[2,3-D]PYRIMIDIN-4-YLSULFANYL)-ACETIC ACID; OTAVA-BB BB7013460024
(5,6-DIHYDRO-IMIDAZO[2,1-B]THIAZOL-3-YL)-ACETIC ACID 158197-27-4 C7H8N2O2S 184.22 OTAVA-BB BB7018771472; CHEMBRDG-BB 4402123; 5,6-DIHYDROIMIDAZO[2,1-B][1,3]THIAZOL-3-YLACETIC ACID; (5,6-DIHYDRO-IMIDAZO[2,1-B]THIAZOL-3-YL)-ACETIC ACID; CBI-BB ZERO/008543; OTAVA-BB 7018771472
(5,5-DIMETHYL-2-OXO-TETRAHYDRO-FURAN-3-YL)-ACETIC ACID 412298-86-3 C8H12O4 172.18 (5,5-DIMETHYL-2-OXO-TETRAHYDRO-FURAN-3-YL)-ACETIC ACID; Zinc00178389; Zinc00178391
(5,5-Dimethyl-2,4-dioxoimidazolidin-1-yl)acetic acid 64942-63-8 C7H10N2O4 186.17 (5,5-DIMETHYL-2,4-DIOXO-IMIDAZOLIDIN-1-YL)-ACETIC ACID; (5,5-DIMETHYL-2,4-DIOXO-1-IMIDAZOLIDINYL)ACETIC ACID; ALINDA 98026
(5,5,8,8-Tetramethyl-5,6,7,8-tetrahydronaphth-2-yl)methylamine 148749-58-0 C15H23N 0 (5,5,8,8-TETRAMETHYL-5,6,7,8-TETRAHYDRONAPHTH-2-YL)METHYLAMINE
(5)HELICENE 188-52-3 C22H14 278.35 (5)HELICENE; DIBENZO(C,G)PHENANTHRENE; [pR,(-)]-Dibenzo[c,g]phenanthrene; (+)-Pentahelicene; [pS,(+)]-Dibenzo[c,g]phenanthrene
(4Z,7Z)-4,7-Decadienal 22644-09-3
(4-TRIFLUOROMETHYL-PHENYL)-PROPYNOIC ACID ETHYL ESTER 337510-18-6 C12H9F3O2 242.19 (4-TRIFLUOROMETHYL-PHENYL)-PROPYNOIC ACID ETHYL ESTER
(4-TRIFLUOROMETHYLPHENOXY) ACETIC ACID ETHYL ESTER 442125-30-6 C11H11F3O3 248.2 (4-TRIFLUOROMETHYLPHENOXY) ACETIC ACID ETHYL ESTER
(4-TRIFLUOROMETHYLBENZENESULFONYL)ACETONITRILE 186405-37-8 C9H6F3NO2S 249.2096496 (4-TRIFLUOROMETHYLBENZENESULFONYL)ACETONITRILE; 2-(4-TRIFLUOROMETHYLBENZENESULPHONYL)ACETONITRILE; [4-(TRIFLUOROMETHYL)PHENYLSULFONYL]ACETONITRILE
(4-TOLYLETHYL)METHYLDICHLOROSILANE 63126-87-4 C10H14Cl2Si 233.21 (4-TOLYLETHYL)METHYLDICHLOROSILANE; (PARA-METHYLPHENETHYL)METHYLDICHLOROSILANE; P-(METHYLPHENETHYL)METHYLDICHLOROSILANE; DICHLOROMETHYL(4-METHYLPHENETHYL)SILANE, 95%; Methyl[2-(p-tolyl)ethyl]dichlorosilane; Benzene, (2-(dichloromethylsilyl)ethyl)methyl-;
(4-Tetrazol-1-yl-phenyl)acetic acid 462068-57-1 C9H8N4O2 204.19 (4-Tetrazol-1-yl-phenyl)acetic acid; [4-(1H-Tetrazol-1-yl)phenyl]acetic acid
(4-tert-Butylphenyl)hydrazine 61765-93-3 C10H16N2 164.25 4-TERT-BUTYL-PHENYL-HYDRAZINE; 1-(4-tert-Butylphenyl)hydrazine; p-tert-Butylphenylhydrazine
(4-TERT-BUTYLPHENYL)DIPHENYLSULFONIUM TRIFLATE 145612-66-4 C23H23F3O3S2 468.55 DIPHENYL(4-T-BUTYLPHENYL)SULFONIUM TRIFLATE; DIPHENYL(4-T-BUTYLPHENYL)SULPHONIUM TRIFLATE; (4-TERT-BUTYLPHENYL)DIPHENYLSULFONIUM TRIFLATE; (4-TERT-BUTYLPHENYL)DIPHENYLSULFONIUM TRIFLUOROMETHANESULFONATE; (4-TERT-BUTYLPHENYL)DIPHENYLSULFONIUM TR; [4-(1,1-D
(4-TERT-BUTYLCYCLOHEXYL)AMINE 95% 5400-88-4 C10H21N 155.28
(4-tert-Butyl-benzyl)-furan-2-ylmethyl-amine 436088-73-2 C16H21NO 243.34 (4-TERT-BUTYL-BENZYL)-FURAN-2-YLMETHYL-AMINE; 1-(4-TERT-BUTYLPHENYL)-N-(2-FURYLMETHYL)METHANAMINE
(4-TERT-BUTOXYCARBONYLAMINO-PHENYL)-[(9H-FLUOREN-9-YLMETHOXYCARBONYLAMINO)]-ACETIC ACID 265321-13-9 C28H28N2O6 488.53172 2-(9H-fluoren-9-ylmethoxycarbonylamino)-2-[4-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]aceticacid; 265321-13-9; (4-TERT-BUTOXYCARBONYLAMINO-PHENYL)-[(9H-FLUOREN-9-YLMETHOXYCARBONYLAMINO)]-ACETICACID; PL013826; KB-208450; TX-010818
(4-SEC-BUTYL-PIPERAZIN-1-YL)-OXO-ACETIC ACID 705943-40-4 C10H18N2O3 214.26 (4-SEC-BUTYL-PIPERAZIN-1-YL)-OXO-ACETIC ACID; [4-(2-BUTYL)PIPERAZIN-1-YL]OXO-ACETIC ACID; AKOS BB-6827
(4-SEC-BUTYL-PIPERAZIN-1-YL)-ACETIC ACID 722491-34-1 C10H20N2O2 200.28 AKOS BB-5201; [4-(2-BUTYL)PIPERAZIN-1-YL]ACETIC ACID; (4-SEC-BUTYL-PIPERAZIN-1-YL)-ACETIC ACID
(4S,trans)-1,1-Dimethylethyl-6-aminoethyl-2,2-dimethyl-1,3-dioxane-4-acetate 1105067-89-7 C14H27NO4 273.37 (4R,6R)-6-(2-Aminoethyl)-2,2-dimethyl-1,3-dioxane-4-acetic Acid 1,1-Dimethylethyl Ester
(4S,5S)-4,5-DI(AMINOMETHYL)-2,2-DIMETHYLDIOXOLANE, 99+% 119322-88-2 C7H16N2O2 160.21414 (4S,5S)-4,5-DI(AMINOMETHYL)-2,2-DIMETHYLDIOXOLANE, 99+%
(4S,5S)-4,5-bis-(Methoxycarbonyl)-1,3-dioxolane 137568-30-0
(4S,5S)-1,3-DIMETHYL-4,5-DIPHENYL-2-[(R)-1-BENZYL-2-HYDROXYETHYLIMINO]IMIDAZOLIDINE 210468-90-9 C25H27N3O 385.5 (2R)-2-[[(4S,5S)-1,3-dimethyl-4,5-diphenylimidazolidin-2-ylidene]amino]-3-phenylpropan-1-ol; (4S,5S)-1,3-Dimethyl-4,5-diphenyl-2-[(R)-1-benzyl-2-hydroxyethylimino]imidazolidine; 210468-90-9; (+)-ChibaG; SCHEMBL15248771; CTK4E5740
(4S,5S)-(+)-2,2-DIMETHYL-5-METHYLAMINO-4-PHENYL-1,3-DIOXANE 124686-47-1 C13H19NO2 221.3 (4S,5S)-(+)-2,2-DIMETHYL-5-METHYLAMINO-4-PHENYL-1,3-DIOXANE; (S,S)-(+)-2,2-Dimethyl-5-methylamino-4-phenyl-1,3-dioxane, 99+% ee, 99+%.; (S,S)-(+)-2,2-Dimethyl-5-methylamino-4-phenyl-1,3-dioxane, 99+% ee
(4S,5R)-3-tert-butoxycarbony-2-(4-anisyl)-4-phenyl-5-oxazolidinecarboxylic acid 196404-55-4 C22H25NO6 399.44 (4S,5R)-3-tert-Butoxycarbonyl-2-(4-anisyl)-4-phenyl-5-oxazolidinecarboxylic acid; (4S,5R)-2-(4-methoxyphenyl)-4-phenyl-3,5-oxazolidinedicarboxylic acid 3-(1,1-dimethylethyl)ester
(4S,2RS)-2-METHYLTHIAZOLIDINE-4-CARBOXYLIC ACID 205985-91-7 C5H9NO2S 147.2 (4S,2RS)-2-METHYLTHIAZOLIDINE-4-CARBOXYLIC ACID; 4-Thiazolidinecarboxylicacid,2-methyl-,(4S)-(9CI); (4S,2RS)-2-Methylthiazolidine-4-carboxylic acid,97%
(4S,2RS)-2-ETHYLTHIAZOLIDINE-4-CARBOXYLIC ACID 205985-92-8 C6H11NO2S 161.22 (4S,2RS)-2-ETHYLTHIAZOLIDINE-4-CARBOXYLIC ACID; 4-Thiazolidinecarboxylicacid,2-ethyl-,(4S)-(9CI); (4S,2RS)-2-Ethylthiazolidine-4-carboxylic acid,99%
(4S,2RS)-2,5,5-TRIMETHYLTHIAZOLIDINE-4-CARBOXYLIC ACID 212755-85-6 C7H13NO2S 175.25 CHEBI:141059; (4S)-2,5,5-trimethyl-1,3-thiazolidine-4-carboxylicacid; (S)-2,5,5-Trimethyl-thiazolidine-4-carboxylicacid; SBB017062; 212755-85-6; AC1MBG3I
(4S,2R,S)-2-PHENYLTHIAZOLIDINE-4-CARBOXYLIC ACID 205985-93-9 C10H11NO2S 209.26 S-2-PHENYL-THIAZOLIDINE-4-CARBOXYLIC ACID; (4S,2R,S)-2-PHENYLTHIAZOLIDINE-4-CARBOXYLIC ACID; (4S,2RS)-2-Phenylthiazolidine-4-carboxylic acid,98%
(4S)-6-CHLORO-4-(2-CYCLOPROPYLETHYNYL)-4-(TRIFLUOROMETHYL)-3,4-DIHYDROQUINAZOLIN-2(1H)-ONE 214287-88-4 C14H10ClF3N2O 314.69000
(4S)-4-Propyl-2-oxazolidinone 165115-69-5 C6H11NO2 129.15704 (4S)-4-Propyl-2-oxazolidinone
(4S)-4-Phenyl-3-(1,2-propadienyl)-2-oxazolidinone 845885-63-4 C12H11NO2
(4S)-4-Methyl-L-proline HCl 6734-41-4 C6H12ClNO2 165.61 cis-4-Methyl-L-proline, (2S,4S)-2-Carboxy-4-methylpyrrolidine
(4S)-4-Ethyl-2-oxazolidinone 13896-06-5 C5H9NO2 115.13046 (4S)-4-Ethyl-2-oxazolidinone
(4S)-4-butyl-L-glutamic acid 14344-45-7 C9H17NO4 203.23 (2R,4R)-2-AMINO-4-BUTYL-PENTANEDIOIC ACID; (4R)-4-BUTYL-D-GLUTAMIC ACID; (4R)-4-butyl-L-glutamic acid; REF DUPL: (4R)-4-butyl-L-glutamic acid
(4S)-4-Butyl-2-oxazolidinone 158249-51-5 C7H13NO2 143.18362 (4S)-4-Butyl-2-oxazolidinone
(4S)-4,5-Bis-[S-(1-ethoxyethyl)-mercaptoacetamido]-pentanoic acid-2,3,5,6-tetrafluorophenyl ester 125488-70-2 C23H32F4N2O6S2 572.64 4,5-di-[S-(1-ethoxyethyl)mercaptoacetamido]-pentanoic acid-2,3,5,6-tetrafluorophenyl ester; (4S)-4,5-Bis-[2-((RS)-1-ethoxy-ethylsulfanyl)acetamido]-pentanoic acid-2,3,5,6-tetrafluorophenyl ester
(4S)-4-(naphthalen-2-ylmethyl)-L-glutamic acid 207497-61-8 C16H17NO4 287.31 (4S)-4-(naphthalen-2-ylmethyl)-L-glutamic acid
(4S)-3-[(2R,3R)-4-chloro-3-(2,4-difluorophenyl)-3-hydroxy-2-methyl-1-oxobutyl]-4-(phenylmethyl)-2-oxazolidinone 169218-76-2 C21H20ClF2NO4 423.84
(4S)-3-[(2R)-2-[(2R)-2-(2,4-Difluorophenyl)-2-oxiranyl]-1-oxopropyl]-4-(phenylmethyl)-2-oxazolidinone 166948-47-6 C21H19F2NO4 387.38 (4S)-3-[(2R)-2-[(2R)-2-(2,4-Difluorophenyl)-2-oxiranyl]-1-oxopropyl]-4-(phenylmethyl)-2-oxazolidinone;
(4S)-3-(2-Bromo-1-oxopropyl)-4-(phenylmethyl)-2-oxazolidinone 192864-91-8 C13H14BrNO3 312.16 4-benzyl-3-(2-bromopropanoyl)-1,3-oxazolidin-2-one; (4S)-3-(2-BROMO-1-OXOPROPYL)-4-(PHENYLMETHYL)-2-OXAZOLIDINONE; 192864-91-8; AN-30258; 4-benzyl-3-(2-bromopropanoyl)oxazolidin-2-one
(4S)-1,1-dioxide-6-chloro-3,4-dihydro-2H-Thieno[3,2-e]-1,2-thiazin-4-ol 160982-16-1 C6H6ClNO3S2 239.7 (4S)-1,1-dioxide-6-chloro-3,4-dihydro-2H-Thieno[3,2-e]-1,2-thiazin-4-ol; (S)-3,4-Dihydro-6-chloro-4-hydroxy-2H-thieno[3,2-e]-1,2-thiazine-1,1-dioxide; (S)-3,4-Dihydro-6-chloro-4-hydroxy-4H-thieno[3,2-e]-1,2-thiazine-1,1-dioxide
(4S)-(-)-T-BUTYLDIMETHYLSILOXY-2-CYCLOPENTEN-1-ONE 61305-36-0 C11H20O2Si 212.36 (S)-4-TERT-BUTYLDIMETHYLSILYLOXY-2-CYCLOPENTEN-1-ONE; (S)-4-(TERT-BUTYL-DIMETHYLSILYLOXY)CYCLOPENT-2-ENONE; (4S)-(-)-T-BUTYLDIMETHYLSILOXY-2-CYCLOPENTEN-1-ONE; (S)-4-tert-Butyldimethylsilyloxy-2-cyclopenten-1-one,95%, (98% ee); (S)-4-tert-Butyldimethylsil
(4S)-(-)-4,5-DIHYDRO-2-[2'-(DIPHENYLPHOSPHINO)PHENYL]-4-ISOPROPYLOXAZOLE 148461-12-5 C24H24NOP 373.43 (S)-(-)-2-[2-(DIPHENYLPHOSPHINO)PHENYL]-4,5-DIHYDRO-4-ISOPROPYLOXAZOLE; (S)-(-)-2-[2-(DIPHENYLPHOSPHINO)PHENYL]-4-ISOPROPYL-2-OXAZOLINE; (4S)-(-)-4,5-DIHYDRO-2-[2'-(DIPHENYLPHOSPHINO)PHENYL]-4-ISOPROPYLOXAZOLE
(4R-cis)-6-Aminomethyl-2,2-dimethyl-1,3-dioxane-4-acetic acid tert-butyl ester 853881-01-3 C13H25NO4 259.34 (4R-cis)-6-Aminomethyl-2,2-dimethyl-1,3-dioxane-4-acetic acid tert-butyl ester; (4R-cis)-1,1-Dimethylethyl-6-aminomethyl-2,2-dimethyl-1,3-dioxane-4-acetate
(4R,5S)-rel-1-[4-(1,1-Dimethylethyl)-3-methoxybenzoyl]-4-(methoxymethyl)-2-(1H-pyrazol-1-ylmethyl)-5-(2-thiazolyl)-D-proline 885264-71-1 C26H32N4O5S 512.628 GSK 625433; D-Proline, 1-[4-(1,1-dimethylethyl)-3-methoxybenzoyl]-4-(methoxymethyl)-2-(1H-pyrazol-1-ylmethyl)-5-(2-thiazolyl)-, (4R,5S)-rel-
(4R,5S)-4-methyl-5-phenyl-2-oxazolidinone 77973-39-6 0
(4R,5S)-1-BENZYL-4-(4-FLUORO-PHENYL)-5-HYDROXYMETHYL-PYRROLIDINE-3-CARBOXYLIC ACID TERT-BUTYL ESTER 1217855-82-7 C23H28FNO3 385.4717232 (4R,5S)-1-BENZYL-4-(4-FLUORO-PHENYL)-5-HYDROXYMETHYL-PYRROLIDINE-3-CARBOXYLIC ACID TERT-BUTYL ESTER
(4R,5S)-(2,2-DIMETHYL-5-VINYL-1,3-DIOXOLAN-4-YL)METHAN-1-OL 127758-25-2 C8H14O3 158.19496 (4R,5S)-(2,2-DIMETHYL-5-VINYL-1,3-DIOXOLAN-4-YL)METHAN-1-OL
(4R,5R)-5-(4-Chlorophenyl)-4-methyl-1,3-thiazolidin-2-one 78587-59-4 C10H10ClNOS 227.7105 Trans-5-(4-Chlorophenyl)-4-methylthiazolidin-2-one
(4R,5R)-4,5-BIS(MESYLOXYMETHYL)-1,3,2-DIOXATHIOLANE 2,2-DIOXIDE 208338-09-4 C6H12O10S3 340.34848;g/mol [(4R,5R)-5-(methylsulfonyloxymethyl)-2,2-dioxo-1,3,2-dioxathiolan-4-yl]methylmethanesulfonate; (4R,5R)-4,5-BIS(MESYLOXYMETHYL)1,3,2-DIOXATHIOLANE2,2-DIOXIDE; 208338-09-4; CTK4E5254; HE230824; (4R,5R)-4,5-BIS(MESYLOXYMETHYL)-1,3,2-DIOXATHIOLANE2,2-DIOXIDE
(4R,5R)-4,5-bis(Aminomethyl)-2-isklrklg-1,3-dioxolane 146092-05-9 C8H18N2O2 174.24072 (4R,5R)-4,5-bis(Aminomethyl)-2-isklrklg-1,3-dioxolane; ((4R,5R)-2-isopropyl-1,3-dioxolane-4,5-diyl)dimethanamine
(4R,5R)-2-Methyl-a,a,a\',a\',2-pentaphenyl-1,3-dioxolane-4,5-dimethanol 109306-21-0 C36H32O4 528.64 (2R,3R)-1,1,4,4-TETRAPHENYL-2,3-O-(1-PHENYLETHYLIDENE)-1,2,3,4-BUTANETETROL; (2R,3R)-2,3-O-(1-PHENYLETHYLIDENE)-1,1,4,4-TETRAPHENYL-1,2,3,4-BUTANETETROL; (+)-4,5-BIS[HYDROXY(DIPHENYL)METHYL]-2-METHYL-2-PHENYL-1,3-DIOXOLANE; (+)-(4R,5R)-BIS[HYDROXY(DIPHENY
(4R,5R)-2-CHLORO-1,3-DIMETHYL-4,5-DIPHENYL-1-IMIDAZOLINIUM CHLORIDE 851487-56-4 C17H18Cl2N2 321.24400
(4R,5R)-[5-(4-Nitrophenyl)-2-phenyl-4,5-dihydro-oxazol-4-yl]methanol 256475-85-1 C16H14N2O4 298.29 (4R,5R)-[5-(4-NITROPHENYL)-2-PHENYL-4,5-DIHYDRO-OXAZOL-4-YL]METHANOL
(4R,5R)-[5-(4-Iodophenyl)-2-phenyl-4,5-dihydro-oxazol-4-yl]methanol 927689-68-7 C16H14INO2 379.19 (4R,5R)-[5-(4-IODOPHENYL)-2-PHENYL-4,5-DIHYDRO-OXAZOL-4-YL]METHANOL
(4R)-MONASTROL 268739-54-4 C14H16N2O3S 292.35 (4R)-MONASTROL
(4R)-4-T-BUTYL-2-METHYL 2-OXAZOLINE 137542-74-6 C8H15NO 141.21 (4R)-4-T-BUTYL-2-METHYL 2-OXAZOLINE; (4S)-4-T-BUTYL-2-METHYL 2-OXAZOLINE
(4R)-4-Propyl-2-oxazolidinone 157922-13-9 C6H11NO2 129.15704 (4R)-4-Propyl-2-oxazolidinone
(4R)-4-Phenyl-3-(1,2-propadienyl)-2-oxazolidinone 256382-50-0 C12H11NO2 201.22124;g/mol (4R)-4-phenyl-3-propa-1,2-dienyl-1,3-oxazolidin-2-one; (4R)-4-PHENYL-3-(1,2-PROPADIENYL)-2-OXAZOLIDINONE; 256382-50-0; PubChem11702; CTK4F6164; ZINC38339007
(4R)-4-Mercapt-pyrolidin-2-thione 141629-16-5 C23H24N2O 0 (4R)-4-Mercapt-pyrolidin-2-thione
(4R)-4-Isobutyl-2-oxazolidinone 161106-42-9 C7H13NO2 143.18362 (4R)-4-Isobutyl-2-oxazolidinone
(4R)-4-[(5R,8R,9S,10S,13R,14S,17R)-10,13-dimethyl-3,12-dioxo-2,4,5,6,7,8,9,11,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoic acid 2958-05-6 C24H36O4 388.54 g/mol
(4R)-3-[(2S,3S)-2-Acetyl-3-[3-[bis(phenylmethyl)amino]phenyl]-1-oxopentyl]-4-phenyl-2-oxazolidinone 188559-10-6 C36H36N2O4 560.68 [4R-[3(2S*,3S*),4R*]]-3-[2-Acetyl-3-[3-[bis(phenylmethyl)amino]phenyl]-1-oxopentyl]-4-phenyl-2-oxazolidinone
(4R)-3-[(2S)-3-Methyl-1-oxo-2-[(phenylmethoxy)methyl]butyl]-4-(phenylmethyl)-2-oxazolidinone 365541-74-8 C23H27NO4 381.46 (4R)-4-benzyl-3-[(2S)-3-methyl-2-(phenylmethoxymethyl)butanoyl]-1,3-oxazolidin-2-one; 365541-74-8; Aliskireninter-10; SCHEMBL3782695; OSMMPQFRVPFIQZ-NHCUHLMSSA-N; (4R)-3-[(2S)-3-METHYL-1-OXO-2-[(PHENYLMETHOXY)METHYL]BUTYL]-4-(PHENYLMETHYL)-2-OXAZOLIDINONE
(4R)-3,4-Dihydro-5-methyl-2H-1-benzopyran-4-amine hydrochloride 1213506-92-3 C10H13NO 163.21632;g/mol (4R)-3,4-Dihydro-5-methyl-2H-1-benzopyran-4-amine hydrochloride; (R)-5-Methylchroman-4-amine
(4R)-2-Thioxo-1,3-thiazolidine-4-carboxylic acid 98169-56-3 C4H5NO2S2 163.2210 (4R)-2-Thioxo-1,3-thiazolidine-4-carboxylic acid
(4R)-1-(Phenylmethoxy)-4-[(2,4,5-trifluorophenyl)methyl]-2-azetidinone 767352-30-7 C17H14F3NO2 321.29 (4R)-1-(Phenylmethoxy)-4-[(2,4,5-trifluorophenyl)methyl]-2-azetidinone
(4-pyridylthio)acetyl chloride hydrochloride 27230-51-9 224.11 4-PYRIDYLMERCAPTOACETYL CHLORIDE HYDROCHLORIDE; (4-pyridylthio)acetyl chloride hydrochloride; 4-PYRIDYLMERCAPTOACETYL CHLORIDE HCL
(4-PYRIDIN-4-YL-PHENYL)-ACETIC ACID 55397-08-5 C13H11NO2 213.23 (4-PYRIDIN-4-YL-PHENYL)-ACETIC ACID; 4-(4'-PYRIDYL)PHENYLACETIC ACID
(4-PYRIDIN-2-YL-PHENYL)-ACETIC ACID 51061-67-7 C13H11NO2 213.23 4-(2'-PYRIDYL)PHENYLACETIC ACID; (4-PYRIDIN-2-YL-PHENYL)-ACETIC ACID
(4-PROPYL-PHENYL)-HYDRAZINE 92178-77-3 C9H14N2 150.22 (4-PROPYL-PHENYL)-HYDRAZINE
(4-Propylcyclohexyl)benzene 177533-41-4 C15H22 202.34 (4-Propylcyclohexyl)Benzene
(4-propoxyphenyl)methanol 90925-43-2 C10H14O2
(4-PROPOXY-PHENYL)-ACETIC ACID 26118-57-0 C11H14O3 194.23 (4-PROPOXY-PHENYL)-ACETIC ACID; 4-PROPOXY-BENZENEACETIC ACID; BENZENEACETIC ACID, 4-PROPOXY-; OTAVA-BB 7020330586; UKRORGSYN-BB BBV-106012
(4-Propoxybenzyl)amine 21244-33-7 C10H15NO 165.23 (4-Propoxybenzyl)amine; 4-(n-Propyloxy)benzylamine
(4-Piperidinophenyl)methylamine 214759-73-6 C12H18N2 190.28 AKOS B033618; (4-PIPERIDINOPHENYL)METHYLAMINE; 4-PIPERIDINOBENZYLAMINE; 1-(4-PIPERIDIN-1YLPHENYL)METHANAMINE; 4-(Piperidin-1yl)benzylamine; (4-Piperidin-1ylphenyl)methylamine
(4-PIPERIDIN-4-YL-PHENYL)-METHANOL 885274-59-9 C12H17NO 191.27 (4-PIPERIDIN-4-YL-PHENYL)-METHANOL
(4-piperidin-1-ium-1-ylcyclohexyl) butanoate chloride 1702-16-5 C15H28ClNO2 289.841 g/mol
(4-piperidin-1-ium-1-ylcyclohexyl) 3,4,5-trimethoxybenzoate chloride 1532-13-4 C21H32ClNO5 413.935 g/mol
(4-PHENYLTHIOPHENYL)DIPHENYLSULFONIUM TRIFLATE 111281-12-0 C25H19F3O3S3 520.61 DIPHENYL(4-THIOPHENYLPHENYL)SULFONIUM TRIFLATE; (4-PHENYLTHIOPHENYL)DIPHENYLSULFONIUM TRIFLATE; (4-PHENYLTHIOPHENYL)DIPHENYLSULFONIUM TRIFLUOROMETHANESULFONATE; Diphenyl[4-(phenylthio)phenyl]sulphonium triflate; (4-PHENYLTHIOPHENYL)DIPHENYLSULFONIUM TR
(4-PHENYL-PIPERAZIN-1-YL)-PIPERIDIN-4-YL-METHANONE HYDROCHLORIDE 731832-24-9 C16H24ClN3O 273.37300
(4-phenylphenyl) N-methylcarbamate 5579-05-5 C14H13NO2 227.259 g/mol
(4-Phenylcyclohexyl)methanol 83811-73-8 C13H18O 190.28142 (4-PHENYLCYCLOHEXYL)METHANOL
(4-phenyl-1-bicyclo[2.2.2]octanyl)azanium chloride 10206-89-0 C14H20ClN 237.768 g/mol
(4-PHENOXYPHENYL)METHYLAMINE HYDROCHLORIDE 169944-04-1 C13H14ClNO 235.70936 (4-PHENOXYPHENYL)METHYLAMINE HYDROCHLORIDE; 4-PHENOXYBENZYLAMINE HCL
(4-PHENOXY-PHENYL)-HYDRAZINE 17672-28-5 C12H12N2O 200.24 (4-PHENOXY-PHENYL)-HYDRAZINE
(4-PHENOXYPHENOXY)ACETIC ACID 38559-90-9 C14H12O4 0 (4-phenoxyphenoxy)aceticacid;38559-90-9;2-(4-phenoxyphenoxy)aceticacid;MLS000048559;AC1M6AIR;Oprea1_540058
(4-Nitrophenyl)-(3-trifluoromethyl-phenyl)-methane 86845-31-0 C14H10F3NO2 281.23000
(4-nitrophenyl) selenocyanate 19188-18-2 C7H4N2O2Se 227.079 g/mol
(4-nitrophenyl) N-[4-(phenylmethoxy)phenyl]carbamate 6186-11-4 C20H16N2O5 364.351 g/mol
(4-nitrophenyl) N,N-dimethylsulfamate 1142-27-4 C8H10N2O5S 246.24 g/mol
(4-Nitro-benzyl)-phosphonic acid 1205-62-5 C7H8NO5P 217.115881 (4-Nitro-benzyl)-phosphonic acid
(4-MORPHOLINO-3-NITROPHENYL)METHANOL HYDROCHLORIDE 300665-23-0 C11H15ClN2O4 274.7 (4-MORPHOLINO-3-NITROPHENYL)METHANOL HYDROCHLORIDE; BUTTPARK 96\57-91; (4-Morpholino-3-nitrophenyl)methanolHCl
(4-METHYLTHIOPHENYL)METHYL PHENYL SULF& 187868-29-7 C14H15S2.CF3O3S 396.473 (4-METHYLTHIOPHENYL)METHYL PHENYL SULF&; (4-METHYLTHIOPHENYL)METHYLPHENYL SULFONI
(4-METHYL-THIAZOL-2-YL)-ACETIC ACID METHYL ESTER 117840-81-0 C7H9NO2S 171.22 METHYL (4-METHYL-1,3-THIAZOL-2-YL)ACETATE; (4-METHYL-THIAZOL-2-YL)-ACETIC ACID METHYL ESTER
(4-METHYLSULFANYL-PHENYL)-PHOSPHONIC ACID 46061-42-1 C7H9O3PS 204.183321 (4-METHYLSULFANYL-PHENYL)-PHOSPHONIC ACID
(4-METHYL-PYRIDIN-2-YLOXY)-ACETIC ACID ETHYL ESTER 864684-80-0 C10H13NO3 195.21512 (4-METHYL-PYRIDIN-2-YLOXY)-ACETIC ACID ETHYL ESTER
(4-METHYLPIPERIDINO)(4-PIPERIDINYL)METHANONE HYDROCHLORIDE 690632-27-0 C12H23ClN2O 246.78 (4-METHYLPIPERIDINO)(4-PIPERIDINYL)METHANONE HYDROCHLORIDE; (4-Methylpiperidino)(4-piperidinyl)methanoneHCl
(4-METHYLPIPERIDINO)(2-PIPERIDINYL)METHANONE HYDROCHLORIDE 690634-80-1 C12H23ClN2O 246.78 (4-METHYLPIPERIDINO)(2-PIPERIDINYL)METHANONE HYDROCHLORIDE; (4-Methylpiperidino)(2-piperidinyl)methanoneHCl
(4-METHYL-PIPERAZIN-1-YL)-PIPERIDIN-4-YL-METHANONE 2 HCL 63214-56-2 C11H23Cl2N3O 284.23 (4-METHYL-PIPERAZIN-1-YL)-PIPERIDIN-4-YL-METHANONE 2 HCL; (4-METHYLPIPERAZIN-1-YL)PIPERIDIN-4-YL-METHANONE DIHYDROCHLORIDE; 1-methyl-4-(piperidin-4-ylcarbonyl)piperazine dihydrochloride; 1-methyl-4-(piperidin-4-ylcarbonyl)piperazine2HCl; (4-METHYL-PIPERAZ
(4-METHYL-PIPERAZIN-1-YL)-(S)-PYRROLIDIN-2-YL-METHANONE 100158-68-7 C10H19N3O 197.28 (4-METHYL-PIPERAZIN-1-YL)-(S)-PYRROLIDIN-2-YL-METHANONE; (S)-1-METHYL-4-(2-PYRROLIDINYLCARBONYL)-PIPERAZINE
(4-Methylphenyl)-triphenylphosphonium bromide 6031-78-3 C25H22BrP 433.319941 (4-Methylphenyl)-triphenylphosphonium bromide
(4-Methylphenyl)sulfonyl acetate 26908-82-7 C9H10O4S 214.24 Acetic Acid, Anhydride With P-Toluenesulfonic Acid; Acetic P-Toluenesulfonic Anhydride; (4-METHYLPHENYL)SULFONYL ACETATE
(4-methylphenyl)stibonic acid 5450-68-0 C7H9O3Sb 262.905 g/mol
(4-METHYLPHENYL)ACETONE OXIME 114306-23-9 C10H13NO 163.22 (4-METHYLPHENYL)ACETONE OXIME; 2-PROPANONE, 1-(4-METHYLPHENYL)-, OXIME
(4-Methylphenyl)acetaldehyde 104-09-6 C9H10O 134.1770 (4-Methylphenyl)acetaldehyde
(4-methylphenyl)-(4-methylphenyl)imino-oxidoazanium 955-98-6 C14H14N2O 226.274 g/mol
(4-METHYLPHENOXY) ACETIC ACID ETHYL ESTER 67028-40-4 C11H14O3 194.23 (4-methylphenoxy)-aceticaciethylester; Aceticacid,(4-methylphenoxy)-,ethylester; Ethyl(p-tolyloxy)acetate; (4-METHYLPHENOXY) ACETIC ACID ETHYL ESTER; ETHYL (4-METHYLPHENOXY)ACETATE; ETHYLPARA-CRESOXYACETATE; ETHYL(PARA-TOLYLOXY)ACETATE; Ethyl p-cresoxyac
(4-METHYL-NAPHTHALEN-1-YLMETHYL)-HYDRAZINE 887592-72-5 C12H14N2 186.25 (4-METHYL-NAPHTHALEN-1-YLMETHYL)-HYDRAZINE

Back to Top